KEGG   Sinorhizobium meliloti 1021: SMa1711Help
Entry
SMa1711           CDS       T00058                                 

Gene name
argI2
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00220  Arginine biosynthesis
sme00330  Arginine and proline metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01130  Biosynthesis of antibiotics
sme01230  Biosynthesis of amino acids
Module
sme_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SMa1711 (argI2)
   00330 Arginine and proline metabolism
    SMa1711 (argI2)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SMa1711 (argI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 1235977
NCBI-ProteinID: NP_436187
RhizoBase: SMa1711
UniProt: Q92YE3
Position
pSymA:963647..964540
Genome map
AA seq 297 aa AA seqDB search
MPTLPYAILEAPSTLGLATHGVERLPDQLLHLGLAERIHARHAERLAVPPKEPTPDPETG
ILNARAIAAWSPKLADAVEAVLTAGEFPVVLGGDCTIVLGSMLAFRRRGRYGLLFIDGNA
DFFQPEAEPNGEGASMDLALVTGYGPSHLTDIEGRGPLVRPEDAVAFAYRDHKDQEEYGS
QALPNELKAIDLPAVRAVGIEAAAREAVDHLTREELDGFFIHLDADCLDDAIMPAVDFRM
PGGLSWDELGTALRVALASGKAVGIEITIYNPRLDESGSAGRDLADVLATALGTAAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccttccttatgcaattctcgaagccccttccacgttgggactggcgacccac
ggagtggagcgcctgcccgaccaactcctgcatctcggtcttgcggagcgcatccatgcg
cgccacgccgagcggctggcggtgcctccgaaggagcctacgccagatcccgagaccggc
atcctgaatgcgagggcaattgcggcttggtcgcccaagctcgccgacgcggtggaagcg
gtgcttaccgcgggcgaatttccggtggtactgggcggcgattgcacgatcgtgctgggc
tcgatgctcgcgtttcgccgacgcggccgctacggcctgctcttcatcgacggcaacgcc
gatttcttccagcccgaggcggagcctaatggtgagggcgcctccatggaccttgccctc
gttaccggctacggcccgtcacatctgaccgacattgaaggtcgcggtcctctggtccgt
cccgaagacgctgtcgcgttcgcatatcgcgatcataaggatcaggaggagtacggaagc
caggcgctccctaacgagctcaaggcgattgatcttcccgccgtgcgcgcagtgggcatt
gaggccgccgcgcgcgaagcggttgaccacctgacgcgagaggaactggacggcttcttc
atccatctcgacgccgattgcctcgacgacgccatcatgccggctgtcgatttccgcatg
ccgggcgggttgtcgtgggacgagctagggaccgcgcttcgggttgccttggcgagtggc
aaggcagtcggcatcgagatcaccatctacaatccgcgccttgatgagtccggcagcgcc
gggcgcgacctggccgacgtactggccacagccctcggaacagcagcgtcctga

DBGET integrated database retrieval system