KEGG   Sinorhizobium meliloti 1021: SMa1711Help
Entry
SMa1711           CDS       T00058                                 

Gene name
argI2
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sme01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sme00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymA:963647..964540
Genome map
AA seq 297 aa AA seqDB search
MPTLPYAILEAPSTLGLATHGVERLPDQLLHLGLAERIHARHAERLAVPPKEPTPDPETG
ILNARAIAAWSPKLADAVEAVLTAGEFPVVLGGDCTIVLGSMLAFRRRGRYGLLFIDGNA
DFFQPEAEPNGEGASMDLALVTGYGPSHLTDIEGRGPLVRPEDAVAFAYRDHKDQEEYGS
QALPNELKAIDLPAVRAVGIEAAAREAVDHLTREELDGFFIHLDADCLDDAIMPAVDFRM
PGGLSWDELGTALRVALASGKAVGIEITIYNPRLDESGSAGRDLADVLATALGTAAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccttccttatgcaattctcgaagccccttccacgttgggactggcgacccac
ggagtggagcgcctgcccgaccaactcctgcatctcggtcttgcggagcgcatccatgcg
cgccacgccgagcggctggcggtgcctccgaaggagcctacgccagatcccgagaccggc
atcctgaatgcgagggcaattgcggcttggtcgcccaagctcgccgacgcggtggaagcg
gtgcttaccgcgggcgaatttccggtggtactgggcggcgattgcacgatcgtgctgggc
tcgatgctcgcgtttcgccgacgcggccgctacggcctgctcttcatcgacggcaacgcc
gatttcttccagcccgaggcggagcctaatggtgagggcgcctccatggaccttgccctc
gttaccggctacggcccgtcacatctgaccgacattgaaggtcgcggtcctctggtccgt
cccgaagacgctgtcgcgttcgcatatcgcgatcataaggatcaggaggagtacggaagc
caggcgctccctaacgagctcaaggcgattgatcttcccgccgtgcgcgcagtgggcatt
gaggccgccgcgcgcgaagcggttgaccacctgacgcgagaggaactggacggcttcttc
atccatctcgacgccgattgcctcgacgacgccatcatgccggctgtcgatttccgcatg
ccgggcgggttgtcgtgggacgagctagggaccgcgcttcgggttgccttggcgagtggc
aaggcagtcggcatcgagatcaccatctacaatccgcgccttgatgagtccggcagcgcc
gggcgcgacctggccgacgtactggccacagccctcggaacagcagcgtcctga

DBGET integrated database retrieval system