KEGG   Sinorhizobium meliloti 1021: SMc00077Help
Entry
SMc00077          CDS       T00058                                 

Gene name
thrC1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMc00077 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMc00077 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMc00077 (thrC1)
Enzymes [BR:sme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMc00077 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1009036..1010436)
Genome map
AA seq 466 aa AA seqDB search
MVKYISTRGEAASLGFCDALLAGLARDGGLYLPKEWPALSKKEIRALRGKSYQEIAFTVL
EPFTNGEIPAAKFREMIDEAYATFRHPAVAPLVQTGPNAFVMELFHGSTLAFKDVAMQLL
ARLMDYVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPQGKVSPVQQRQMTT
STASNVHAVAVKGNFDDCQNLVKAMFNDQAFRDRVKLSGVNSINWARIMAQIVYYFTTAV
ALGAPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKNGRYEMRD
VKATTSPSMDIQISSNFERLIFEANERDPAEVRAAMASLRQSGSFTIGDAALKKIRKEFR
AGRASEKDVAKTIRKTFDETGYLLDPHTAIGVFVATKHEKNSAPMVTLATAHPAKFPAAV
KSASGIDPTLPTWLADLMTRAERFDILDPELKSVETFIGERTRVRE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtatatttcgacacggggagaagcggcctctctcggcttttgcgatgctctt
ctggcgggacttgcccgcgacggcgggctttacctgccgaaggaatggccggcactctcg
aagaaggagatccgggcgctgcgcggcaaatcctatcaggagatcgccttcaccgttctc
gaacccttcaccaatggcgagatcccggcggccaagttccgcgagatgatcgacgaggcc
tatgccactttccgtcatccggccgtagcacccctggtccagaccggaccgaacgctttc
gtgatggagctctttcacggttcgacgctcgccttcaaggacgtcgccatgcagttgctc
gcccggctgatggactatgttcttgccgaacggggcgagcgggcgacgatcgtgggagcg
acatcaggcgataccggcggtgccgcgatcgacgccttcgccggccgcgaccgcaccgac
atcttcatcctctttccgcagggcaaagtgtcgccggtgcagcaaagacagatgaccacg
tccacggcatcgaacgtgcacgcggttgccgtcaaaggcaatttcgacgactgccagaac
ctggtcaaagccatgttcaacgaccaggccttccgcgaccgcgtgaagctttccggcgtc
aattcgatcaactgggcgcgcatcatggcccagatcgtctactatttcacgacggcggtc
gctctcggcgcgcccgaccggaagatctccttcaccgtgcctaccggcaatttcggcgat
attttcgcaggctacgtcgccaagcgcatgggtctgccgatcgacaagctgatcatcgcc
accaacgaaaacgacattctggcgcgcacgctgaagaacggccgctacgagatgcgcgac
gtcaaggcgacgacctcgccttcgatggacatccagatctcgtcgaacttcgaaaggctc
atcttcgaggcgaacgagcgcgatccggcggaagtccgcgcggccatggcgagcctcagg
caatccggctcgttcacgatcggcgacgcagcgctgaaaaaaatccgcaaggaatttcgc
gccggccgcgcctcggagaaagatgtggcgaaaacgatccgcaagaccttcgacgagacc
ggctatctccttgatccgcatacggcaatcggcgttttcgtggcaaccaagcacgagaag
aactccgccccgatggtcacccttgcgactgcccatccggcaaaatttcccgccgcagta
aaatcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctcatgactagg
gcggagcgtttcgacatcctggatccggagctcaagagcgtcgaaaccttcatcggcgag
cgtacccgcgttcgggaatag

DBGET integrated database retrieval system