KEGG   Sinorhizobium meliloti 1021: SMc00462Help
Entry
SMc00462          CDS       T00058                                 

Gene name
folP
Definition
dihydropteroate synthase antibiotic resistance transferase folate protein (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sme00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1961819..1962670)
Genome map
AA seq 283 aa AA seqDB search
MTYDPFQPSRWHLAHGRGLELGPRGVLMAIINVTPDSFSDGGRFADPDAAVRAALRALEA
GAEILDIGGESTRPDAKPVSADEEQARILPVIAAIARQSQVVISVDTYRAETARLAVDAG
AHIVNDVYGLQREPAIATVAAETGAGLCIMHTGRDREKLSDVIEDQFHFLERSLQIAADA
GVAREGIVLDPGFGFAKDTNENLELMARFRALHEFRRPLLVGTSRKRFVGAVTGREAGGR
DVGTAATTALLRTAGAAIFRVHDVAINRDALAVADAMLAAKNS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgatccatttcagccttctcgctggcatttggcgcatggacgcggtctcgaa
ctgggcccgcgtggcgttttgatggcgatcatcaatgttacaccggattcattttccgat
ggtgggcgattcgctgatcctgacgctgctgtcagagccgcgctgcgcgcactggaggcg
ggcgcggaaatcctggatattggcggcgaatccacgcgcccggacgccaaaccggtcagc
gccgacgaggaacaggcccgcatcctgcccgttatcgcggcgatcgcgcggcagtcccag
gtcgtcatttcggtcgatacttaccgcgcggaaaccgcccgtttggcggttgacgccggc
gcccacatcgtcaacgacgtgtacgggctccagcgcgagccggcgatcgcgaccgtggcg
gccgaaacgggcgccgggctctgcatcatgcataccgggcgcgaccgggagaaactgagc
gatgtgatcgaggatcagttccatttcctggaacgttccctgcagatcgccgccgacgcc
ggcgtagcgcgggaagggatcgtgctcgatccgggcttcgggttcgcgaaggacacgaac
gagaacctagagctgatggcacgcttccgggcgttgcatgagtttcgacggccgcttctc
gtcggaacgtcgcgcaagcgcttcgtcggcgcggtgaccggccgggaggcgggaggccgc
gacgtcggtaccgccgcgacgacggcgctcctcagaactgccggcgctgctatttttcgg
gtacatgatgtcgcaatcaacagggatgcgttagcggtggccgatgctatgctggccgca
aagaacagctga

DBGET integrated database retrieval system