KEGG   Sinorhizobium meliloti 1021: SMc00465Help
Entry
SMc00465          CDS       T00058                                 

Gene name
folK
Definition
(RefSeq) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00790  Folate biosynthesis
sme01100  Metabolic pathways
Module
sme_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMc00465 (folK)
Enzymes [BR:sme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SMc00465 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-GeneID: 1233474
NCBI-ProteinID: NP_385915
RhizoBase: SMc00465
UniProt: Q92PF3
Position
complement(1960922..1961446)
Genome map
AA seq 174 aa AA seqDB search
MSPNRSWRHAILGLGGNLGDPRRSMAEALRALDARSDCRVVAVSRLYRTPPWGKTDQDWF
FNACAEVETTLDPEALLAACLDIERAMKRVRMERWGPRTIDIDLLTFGDLNRASATLTLP
HPRMTERGFVLKPLADFAADLAVEGRTVIEWLGRADVTGIEVADESVEWWRAEE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaataggagctggcggcacgcgatactcggtctcggcggcaatctcggcgat
ccgcgccggtcgatggcagaagccctgcgggcgctcgacgcgcggtccgattgccgggtc
gtcgcggtgtcgcggctctaccgcaccccgccatggggcaagacggatcaggattggttc
ttcaacgcctgtgcggaagtcgagacgacgctggatccggaggcattgcttgcggcctgt
ctcgatatcgaacgggccatgaagcgcgtgagaatggagcgctggggtccccgaaccatc
gacatcgatctcctgaccttcggtgacctcaacagggcgagcgcgacgctcacgctgcct
catccgcgcatgaccgaacggggcttcgtgctgaagccgctcgccgactttgcggcagac
cttgccgtcgaaggacggacagtcattgaatggctgggccgggcggatgtgacgggcatc
gaagtggccgacgaaagcgtcgaatggtggcgcgcggaggaatag

DBGET integrated database retrieval system