KEGG   Sinorhizobium meliloti 1021: SMc00561Help
Entry
SMc00561          CDS       T00058                                 

Gene name
dnaB
Definition
(RefSeq) replicative DNA helicase (EC:3.6.1.-)
  KO
K02314  
replicative DNA helicase [EC:3.6.4.12]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
DNA replication
Brite
KEGG Orthology (KO) [BR:sme00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SMc00561 (dnaB)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SMc00561 (dnaB)
DNA replication proteins [BR:sme03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SMc00561 (dnaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1230911..1232410)
Genome map
AA seq 499 aa AA seqDB search
MNDAARKLAPLAKDQAEQHYREAPNNLEAEQALLGAILVNNDAFYRVSDFLKPVHLYEPL
HRRIFEIAGEIIRMGKTANPVTVKTFLKADEKVGDLTVAQYLARLAAEAVSIINAEDYGR
AIYDLALRRSLITIGEDMVNIAYDAPLDMPPQSQIEDAERRLFELAETGRYDGGFQSFND
AVALAIDMAGQAFERDGHLSGISTGIHSLDGKMGGLQRSDLIILAGRPGMGKTSLATNIA
YNIAAAYEPEVQPDGSFKAKNGGVVGFYSLEMSSEQLATRIISEQTEVSSSKIRRGDISE
ADFEKLVACSQMMQKVPLYIDQTGGISIAQLAARARRLKRQRGLDVLVVDYIQLMTGSKK
SGENRVQEITEITTGLKALGKELNVPIIALSQLSRAVESREDKRPQLSDLRESGSIEQDA
DVVLFVFREEYYVKNMEPRDEFDPKYEEWKMQMEKVKGTADVIIAKQRHGPTGTVKLAFQ
SEFTRFSDLADPSFTQYEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcagcgcgaaagctcgcccctttggccaaggatcaggcggaacagcattat
cgcgaggcgccgaacaatctggaagcggagcaggccctgctcggcgccattctcgtcaat
aacgacgccttctatcgcgtctcggatttcctgaaacccgtacacctttatgagccgttg
catcgcaggatcttcgagatcgccggcgaaatcatccgcatgggcaagactgccaacccg
gtgacggtcaagaccttcctcaaggccgacgagaaggtcggcgacctgacggttgcacaa
tatctcgcgcgccttgccgccgaagccgtgtccatcatcaatgcggaggattacggccgc
gcgatctacgacctggcgctccgccggtcgctgatcaccatcggtgaagacatggtgaac
atcgcctacgacgcaccgctcgacatgccgccgcagagccagatcgaggacgccgaacgg
cggctgttcgaactcgccgaaacagggcgctacgatggcggcttccaatcgttcaatgac
gcggtagcgctcgcgatcgacatggccggacaggcgttcgagcgggacggtcatctctcc
ggcatttccaccggcatccattcccttgacgggaagatgggcggactccagcgatcggac
ctgatcatcctcgccggccgtccgggcatgggcaagacctcgctcgcgacgaacatcgcc
tacaacatcgccgccgcctacgagccggaagtacagcccgacggctccttcaaggccaag
aacggcggcgtggtcggcttctattcgctcgaaatgtcgtccgaacagctcgccacccgt
atcatctccgagcagaccgaggtctcctcctcgaagatccgccgcggtgatatttcggag
gcggatttcgagaagctcgtcgcctgctcccagatgatgcagaaagtgccgctttatatc
gaccagaccggcggtatctcgatcgcccagcttgccgcgcgcgctcgccgattgaagcgg
cagcgcggcctcgacgtgctcgtggtcgactacatccagctcatgaccggttcgaagaag
tccggcgaaaatcgagtacaggaaatcaccgagatcaccaccggcctcaaggcgctcggc
aaggagctgaacgtgccgatcatcgcgctttcgcagctctcgcgcgcggtggaaagccgc
gaggacaagcggccgcagctctccgacctgcgtgaatcgggctcgatcgaacaggacgcc
gacgtcgtcctcttcgtgttccgcgaggaatattacgtgaagaacatggaaccgcgcgac
gaattcgatccgaaatacgaagagtggaagatgcagatggagaaggtgaagggcacggcc
gacgtgatcatcgccaagcagcgccacggaccgaccggcaccgtcaagctcgccttccag
tcggaattcacgcgcttctcggatctcgccgatccgtcgttcacgcagtacgagcattga

DBGET integrated database retrieval system