KEGG   Sinorhizobium meliloti 1021: SMc00561Help
Entry
SMc00561          CDS       T00058                                 

Gene name
dnaB
Definition
replicative DNA helicase (EC:3.6.1.-)
Orthology
K02314  
replicative DNA helicase [EC:3.6.4.12]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
DNA replication
Brite
KEGG Orthology (KO) [BR:sme00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SMc00561 (dnaB)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SMc00561 (dnaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1230911..1232410)
Genome map
AA seq 499 aa AA seqDB search
MNDAARKLAPLAKDQAEQHYREAPNNLEAEQALLGAILVNNDAFYRVSDFLKPVHLYEPL
HRRIFEIAGEIIRMGKTANPVTVKTFLKADEKVGDLTVAQYLARLAAEAVSIINAEDYGR
AIYDLALRRSLITIGEDMVNIAYDAPLDMPPQSQIEDAERRLFELAETGRYDGGFQSFND
AVALAIDMAGQAFERDGHLSGISTGIHSLDGKMGGLQRSDLIILAGRPGMGKTSLATNIA
YNIAAAYEPEVQPDGSFKAKNGGVVGFYSLEMSSEQLATRIISEQTEVSSSKIRRGDISE
ADFEKLVACSQMMQKVPLYIDQTGGISIAQLAARARRLKRQRGLDVLVVDYIQLMTGSKK
SGENRVQEITEITTGLKALGKELNVPIIALSQLSRAVESREDKRPQLSDLRESGSIEQDA
DVVLFVFREEYYVKNMEPRDEFDPKYEEWKMQMEKVKGTADVIIAKQRHGPTGTVKLAFQ
SEFTRFSDLADPSFTQYEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcagcgcgaaagctcgcccctttggccaaggatcaggcggaacagcattat
cgcgaggcgccgaacaatctggaagcggagcaggccctgctcggcgccattctcgtcaat
aacgacgccttctatcgcgtctcggatttcctgaaacccgtacacctttatgagccgttg
catcgcaggatcttcgagatcgccggcgaaatcatccgcatgggcaagactgccaacccg
gtgacggtcaagaccttcctcaaggccgacgagaaggtcggcgacctgacggttgcacaa
tatctcgcgcgccttgccgccgaagccgtgtccatcatcaatgcggaggattacggccgc
gcgatctacgacctggcgctccgccggtcgctgatcaccatcggtgaagacatggtgaac
atcgcctacgacgcaccgctcgacatgccgccgcagagccagatcgaggacgccgaacgg
cggctgttcgaactcgccgaaacagggcgctacgatggcggcttccaatcgttcaatgac
gcggtagcgctcgcgatcgacatggccggacaggcgttcgagcgggacggtcatctctcc
ggcatttccaccggcatccattcccttgacgggaagatgggcggactccagcgatcggac
ctgatcatcctcgccggccgtccgggcatgggcaagacctcgctcgcgacgaacatcgcc
tacaacatcgccgccgcctacgagccggaagtacagcccgacggctccttcaaggccaag
aacggcggcgtggtcggcttctattcgctcgaaatgtcgtccgaacagctcgccacccgt
atcatctccgagcagaccgaggtctcctcctcgaagatccgccgcggtgatatttcggag
gcggatttcgagaagctcgtcgcctgctcccagatgatgcagaaagtgccgctttatatc
gaccagaccggcggtatctcgatcgcccagcttgccgcgcgcgctcgccgattgaagcgg
cagcgcggcctcgacgtgctcgtggtcgactacatccagctcatgaccggttcgaagaag
tccggcgaaaatcgagtacaggaaatcaccgagatcaccaccggcctcaaggcgctcggc
aaggagctgaacgtgccgatcatcgcgctttcgcagctctcgcgcgcggtggaaagccgc
gaggacaagcggccgcagctctccgacctgcgtgaatcgggctcgatcgaacaggacgcc
gacgtcgtcctcttcgtgttccgcgaggaatattacgtgaagaacatggaaccgcgcgac
gaattcgatccgaaatacgaagagtggaagatgcagatggagaaggtgaagggcacggcc
gacgtgatcatcgccaagcagcgccacggaccgaccggcaccgtcaagctcgccttccag
tcggaattcacgcgcttctcggatctcgccgatccgtcgttcacgcagtacgagcattga

DBGET integrated database retrieval system