KEGG   Sinorhizobium meliloti 1021: SMc00586Help
Entry
SMc00586          CDS       T00058                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sme00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sme00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sme03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sme03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sme03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1257681..1258130
Genome map
AA seq 149 aa AA seqDB search
MTEILFYHLTESKLEDALPPLLDKSIERGWRVVVQTIDAERRDALDTHLWVYRDDSFLPH
GTDAGEFAAVQPILVVADDGNRNAATVRFVVDGAEPPPVSEYERVVFMFDGYDQQQLEAA
RDQWKRLKGEGHNLTYWQQNRDGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatccttttttaccacctgacggaatcgaagctcgaagacgccctgccgccg
ctgctcgacaagagcatagagcgcggctggcgggtggtcgtgcagacgatagacgccgaa
aggcgcgatgcgctggatacgcatctatgggtctatcgggacgacagcttcctgccgcac
ggtacggacgccggcgagttcgcggcggtgcaaccgattctcgtcgttgccgatgacggc
aaccggaatgccgcgactgtgcgctttgtcgtcgacggcgccgagccgccgccggtttcc
gaatatgagcgggttgttttcatgttcgacggctacgaccagcaacagctcgaggcggcg
cgcgatcagtggaagcggctcaagggcgaggggcacaatctcacctattggcagcagaac
cgtgacggaaggtgggaaaagaaggcgtga

DBGET integrated database retrieval system