KEGG   Sinorhizobium meliloti 1021: SMc00741Help
Entry
SMc00741          CDS       T00058                                 

Definition
fatty-acid-CoA ligase (EC:6.-.-.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMc00741
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMc00741
   00620 Pyruvate metabolism
    SMc00741
   00640 Propanoate metabolism
    SMc00741
  Energy metabolism
   00680 Methane metabolism
    SMc00741
Enzymes [BR:sme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SMc00741
Lipid biosynthesis proteins [BR:sme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SMc00741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2840862..2842508)
Genome map
AA seq 548 aa AA seqDB search
MLPKIEDYDELYREFRWRIPERFNIGVAVSDAWAARDPERICLQHFSPDGAHLALTYGDF
AARSSAFAGGLAAHDVSPGERVAILLPQGFEAAIAHAAIYKLGAIALPLALLFGVEALAY
RLKDAGAAAVVTNRFGYERLAAIRGELPELRMVVLAEEDEKPGTVRFRDIAAGQGRFDPA
ETKPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPQPGDRMWTPADWAWA
GGLLNALLPSLFFGVPVVSSPAQKFDAHTAFRIIEEMEVRNAFIPPTALRLLKSVERPRD
RCALKLRTVGSAGEALGRETFEWARAALGVEVSEFYGQTECNIVISSATGLGVAKAGSMG
KAAPGHQVAIIDGEGRVLPPGTVGQVAIRRPDPVMFLGYWRNEEATEAKFIGDWMTTGDQ
GVMDEEGYFTFFGRDDDVITSSGYRIGPSEIEDCLAGHPDVQLAAAVGKPDPLRTEIVKA
YVVLKPGVAAGDETAAGIRDWVKNRLSMHEYPREIAFVDSLPLTTSGKVIRRLLREKAAA
EARAASGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgaagatcgaagactacgacgaactctatcgcgaattccgctggcggatccct
gagaggttcaatatcggcgtggccgtgagcgacgcctgggccgcgcgtgatccggagcgc
atctgtcttcagcatttcagcccggacggcgcgcatcttgcgctgacctatggcgacttc
gccgcgcgttcgtccgcctttgccggcgggcttgccgcgcatgacgtgagccccggcgaa
cgcgtcgccatcctgctgccgcagggtttcgaggcggcgatcgcccatgcggcgatctat
aaactcggcgccatcgcgctgccgctggcactgctcttcggcgtcgaggcgcttgcctat
cggctgaaggatgcgggcgcggcagcagtcgtcaccaatcgcttcggctatgagcggctt
gcggcgatccgcggcgagctgccggaacttcgtatggtcgtcctggccgaggaggacgag
aagcccggcacggttcgtttccgcgatatcgcggcagggcagggccgcttcgaccccgcg
gagacgaagccggacgatccggcgctgatgatctacacctcgggaacgaccggaccgccg
aagggggccttgcacgggcaccgcgtgctgctcggccatctgccgggatttcagttccat
catcatttcctgccacagccgggcgaccgcatgtggacgcccgccgactgggcctgggca
ggcggtctcctgaacgctctgctgccgtcgcttttcttcggtgtgcccgtggtttcctcg
cctgcgcagaaattcgatgcccatacggcgttccggatcatcgaagagatggaggtgcgc
aacgccttcatcccgccgacggcgctcaggctcctcaaatccgtcgagcggccgcgcgat
cgctgcgcgctcaagctccgcaccgtcggttcggcgggagaggcgctcgggcgggagacc
ttcgaatgggccagggcggcgctcggcgtcgaggtgagcgaattctacggccagacggaa
tgcaatatcgtcatctcctctgcgaccggtctcggcgtggcgaaggccggctcgatgggc
aaggcggcaccgggtcatcaggtcgcgatcatcgacggcgaggggcgggtgctgccgccc
ggcacggtcgggcaggtggcgatcaggcgtcccgatccggtgatgttcctcggctattgg
cgcaacgaagaggcgaccgaggccaagtttatcggcgactggatgaccaccggcgaccag
ggcgtcatggacgaagagggctatttcacctttttcggccgtgacgacgacgtcatcacg
tcgtcaggctatcgcatcggtccgagcgagatcgaggattgtctcgccgggcacccggac
gtccagctcgccgcggccgtcggcaaaccggacccgctccggaccgagatcgtcaaggcc
tatgtcgtgctgaaacccggcgtcgctgccggcgacgagaccgcggcagggatccgcgac
tgggtgaagaacaggctgtcgatgcatgaatatccgcgcgagatcgctttcgtcgacagc
ctgcctttgaccacctcgggcaaggtgatccgccggcttctgcgggagaaggcggcggca
gaggcgcgcgccgcgtccggcggctga

DBGET integrated database retrieval system