KEGG   Sinorhizobium meliloti 1021: SMc00741Help
Entry
SMc00741          CDS       T00058                                 

Definition
(RefSeq) fatty-acid-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00010  Glycolysis / Gluconeogenesis
sme00620  Pyruvate metabolism
sme00640  Propanoate metabolism
sme00680  Methane metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMc00741
   00620 Pyruvate metabolism
    SMc00741
   00640 Propanoate metabolism
    SMc00741
  Energy metabolism
   00680 Methane metabolism
    SMc00741
Enzymes [BR:sme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SMc00741
Lipid biosynthesis proteins [BR:sme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SMc00741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1234305
NCBI-ProteinID: NP_386737
RhizoBase: SMc00741
UniProt: Q92MI5
Position
complement(2840862..2842508)
Genome map
AA seq 548 aa AA seqDB search
MLPKIEDYDELYREFRWRIPERFNIGVAVSDAWAARDPERICLQHFSPDGAHLALTYGDF
AARSSAFAGGLAAHDVSPGERVAILLPQGFEAAIAHAAIYKLGAIALPLALLFGVEALAY
RLKDAGAAAVVTNRFGYERLAAIRGELPELRMVVLAEEDEKPGTVRFRDIAAGQGRFDPA
ETKPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPQPGDRMWTPADWAWA
GGLLNALLPSLFFGVPVVSSPAQKFDAHTAFRIIEEMEVRNAFIPPTALRLLKSVERPRD
RCALKLRTVGSAGEALGRETFEWARAALGVEVSEFYGQTECNIVISSATGLGVAKAGSMG
KAAPGHQVAIIDGEGRVLPPGTVGQVAIRRPDPVMFLGYWRNEEATEAKFIGDWMTTGDQ
GVMDEEGYFTFFGRDDDVITSSGYRIGPSEIEDCLAGHPDVQLAAAVGKPDPLRTEIVKA
YVVLKPGVAAGDETAAGIRDWVKNRLSMHEYPREIAFVDSLPLTTSGKVIRRLLREKAAA
EARAASGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgaagatcgaagactacgacgaactctatcgcgaattccgctggcggatccct
gagaggttcaatatcggcgtggccgtgagcgacgcctgggccgcgcgtgatccggagcgc
atctgtcttcagcatttcagcccggacggcgcgcatcttgcgctgacctatggcgacttc
gccgcgcgttcgtccgcctttgccggcgggcttgccgcgcatgacgtgagccccggcgaa
cgcgtcgccatcctgctgccgcagggtttcgaggcggcgatcgcccatgcggcgatctat
aaactcggcgccatcgcgctgccgctggcactgctcttcggcgtcgaggcgcttgcctat
cggctgaaggatgcgggcgcggcagcagtcgtcaccaatcgcttcggctatgagcggctt
gcggcgatccgcggcgagctgccggaacttcgtatggtcgtcctggccgaggaggacgag
aagcccggcacggttcgtttccgcgatatcgcggcagggcagggccgcttcgaccccgcg
gagacgaagccggacgatccggcgctgatgatctacacctcgggaacgaccggaccgccg
aagggggccttgcacgggcaccgcgtgctgctcggccatctgccgggatttcagttccat
catcatttcctgccacagccgggcgaccgcatgtggacgcccgccgactgggcctgggca
ggcggtctcctgaacgctctgctgccgtcgcttttcttcggtgtgcccgtggtttcctcg
cctgcgcagaaattcgatgcccatacggcgttccggatcatcgaagagatggaggtgcgc
aacgccttcatcccgccgacggcgctcaggctcctcaaatccgtcgagcggccgcgcgat
cgctgcgcgctcaagctccgcaccgtcggttcggcgggagaggcgctcgggcgggagacc
ttcgaatgggccagggcggcgctcggcgtcgaggtgagcgaattctacggccagacggaa
tgcaatatcgtcatctcctctgcgaccggtctcggcgtggcgaaggccggctcgatgggc
aaggcggcaccgggtcatcaggtcgcgatcatcgacggcgaggggcgggtgctgccgccc
ggcacggtcgggcaggtggcgatcaggcgtcccgatccggtgatgttcctcggctattgg
cgcaacgaagaggcgaccgaggccaagtttatcggcgactggatgaccaccggcgaccag
ggcgtcatggacgaagagggctatttcacctttttcggccgtgacgacgacgtcatcacg
tcgtcaggctatcgcatcggtccgagcgagatcgaggattgtctcgccgggcacccggac
gtccagctcgccgcggccgtcggcaaaccggacccgctccggaccgagatcgtcaaggcc
tatgtcgtgctgaaacccggcgtcgctgccggcgacgagaccgcggcagggatccgcgac
tgggtgaagaacaggctgtcgatgcatgaatatccgcgcgagatcgctttcgtcgacagc
ctgcctttgaccacctcgggcaaggtgatccgccggcttctgcgggagaaggcggcggca
gaggcgcgcgccgcgtccggcggctga

DBGET integrated database retrieval system