KEGG   Sinorhizobium meliloti 1021: SMc00768Help
Entry
SMc00768          CDS       T00058                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00630  Glyoxylate and dicarboxylate metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01200  Carbon metabolism
Module
sme_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SMc00768 (aceA)
Enzymes [BR:sme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SMc00768 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1232351
NCBI-ProteinID: NP_384818
RhizoBase: SMc00768
UniProt: Q92RX6
Position
complement(779980..781269)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNAPEGRFDGIERPYSAEDVKRLRGSVEIRYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINRT
LQRADQIETAEGKGLSVETWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLVIARTDAEAAKLLTSDIDERDR
PFVDYDAGRTVEGFYQVKNGIEPCIARAIAYAPHCDLIWCETSKPDLEQARKFAEGVHKA
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YRDRQMAAYSELQEAEFAAEANGYTATKHQREVGTGYFDAVSVAITGGQSSTTAMKESTE
HDQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttacaagctcgttccaaatgcgccggaggggcgcttcgacggaatcgag
cggccctattccgccgaggacgtgaagcggctcaggggctcggtggagatccgttattcg
cttgccgaaatgggggcgaaccgcctctggaagctcattcacgaggaggacttcgtcaac
gcactcggcgcgctttccggcaatcaggcgatgcagatggtgcgcgcaggcttgaaggcg
atctatctctccggctggcaggtcgcagccgacgccaacaccgcttcggccatgtatccg
gaccagtcgctctatccggccaacgcggctccggaactcgccaagcgcatcaaccgcacg
cttcagcgcgccgaccagatcgagacggcggaaggcaagggtctctccgtcgagacctgg
ttcgcgccgatcgtcgccgatgcggaagccggcttcggcgggccgctcaacgccttcgag
atcatgaaggccttcatcgaagcgggtgcggcgggcgtccattacgaggaccagctcgcc
tcggaaaagaagtgcggccatctcggcggcaaggtgctgatcccgaccgcggcgcatatc
cggaatctgaacgcggcacggcttgccgccgacgtgatgggcacgccgacgctggtcatc
gcccgcacggacgcagaagcggcgaaactgctcacctctgatatcgacgagcgcgaccgc
ccattcgtcgactatgatgccggccgcaccgtcgagggcttctaccaggtgaagaacggc
atcgagccctgcatcgcccgcgcgatcgcctatgcgccgcattgcgacctcatctggtgc
gagacctccaagcccgacctggagcaggcgcgcaaattcgccgaaggcgtgcacaaggca
catccgggcaagctgctcgcctataattgctcgccgtccttcaactggaagaagaacctc
gacgacgcaacgatcgccaagttccagcgcgaattgggcgccatgggctacaagttccag
ttcatcaccctcgccggcttccatcagctgaactacggcatgttcgaactggcgcgcggc
tacagggatcgtcagatggcggcctattcggagctgcaggaagcggaattcgctgccgaa
gccaacggctatacggcgaccaagcaccagcgcgaagtgggcaccggctatttcgatgcc
gtgtcggtcgcgatcaccggcggccagtcgtcgaccactgccatgaaggaatccaccgag
cacgatcagttccgcccggcagcagaatga

DBGET integrated database retrieval system