KEGG   Sinorhizobium meliloti 1021: SMc00862Help
Entry
SMc00862          CDS       T00058                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00900  Terpenoid backbone biosynthesis
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMc00862 (ipk)
Enzymes [BR:sme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SMc00862 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 1232485
NCBI-ProteinID: NP_384950
RhizoBase: SMc00862
UniProt: Q92RM1
Position
complement(924500..925405)
Genome map
AA seq 301 aa AA seqDB search
MQAGGIPGFALTFAAPAKINLALHVVGQRADGHHLLESLVTFAECGDRVGLIAADRDRFT
VSGRFATDLSAEGNGGNLVLRARDLLRRELAAQGRMAGPVHLHLEKNLPIASGIGGGSAD
AAATLRGLLSLWGATVEAASLNSLALQLGADVPMCLDRGPLVARGIGEEITPLPDLPPFD
VVLVNPLVAVSTPVIFRSLVRKTNPPLVLPEDARSTAEWLTAMAAMRNDLEPPARAHEPM
IETVSNALRDAGAALVRMSGSGATCFGLFTGMKSAERAAETISAGHPRWYVQATRTAGKS
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaggcggcattccgggcttcgcactgacctttgcggcgcccgccaagatcaat
ctcgcgctgcacgtcgtcgggcagcgcgccgacggccaccatctgctggaaagcctggtg
accttcgccgaatgtggcgaccgggtcgggctgatcgcggcggacagggaccgtttcacg
gtgtcgggccgcttcgcgaccgacctttcagccgagggcaatggtggtaatctcgtgctc
cgcgcccgggacctgctgcggcgcgagcttgcggcgcagggtagaatggcaggcccggtt
catctgcatctcgagaagaacctgccgatagcatcggggatcggcggcggctcggccgat
gcagccgcgactctgcgcgggctgctgtcgctctggggcgcgactgtcgaagcggcaagc
ctcaacagccttgcgctgcagctcggcgcggacgtcccgatgtgtctcgaccgggggccc
ctcgtcgcgagaggcatcggcgaagagatcacgcctcttcccgatctgccgcccttcgac
gtcgtcctcgtcaatcccctcgtcgcggtctccacgccggttatcttccgatcgctcgtc
aggaagaccaatcctccgctggtcttgcctgaagatgcccgctcgactgccgaatggctg
acggccatggcggccatgcggaacgacctggagccgccggcacgtgcgcacgagccgatg
atcgaaaccgtctcgaacgcattgcgcgacgcaggcgcggcgctcgtgcggatgtccggc
tcgggtgccacctgcttcggcctgttcacggggatgaaaagcgccgaacgtgccgctgag
accatttccgccggccacccgcgatggtacgttcaggcgacgcgaaccgcgggaaaatca
ggataa

DBGET integrated database retrieval system