KEGG   Sinorhizobium meliloti 1021: SMc00894Help
Entry
SMc00894          CDS       T00058                                 

Gene name
kdtA
Definition
3-deoxy-D-manno-octulosonic-acid transferase (EC:2.-.-.-)
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:sme00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
888315..889628
Genome map
AA seq 437 aa AA seqDB search
MSSLRARLALSGYRWLGTAVYPFFWSYLALRAAKGKEDPARRRERYGYASAPRPQGPLVW
FHAASVGETNAVTPLIKEIRRRGIAVVLTTGTTTSARVAAERLGSAVVHQYVPLDFKPAV
SRFLEYWQPDLAIIAESEIWPMTIIELGRRHIPQVLVNGRLSDRTFARWRRRPSLADALF
ENLALVIAQSDVDAERFRTLGALPVTVSGNLKVDNEAPPHDPRDLREYRQQIGARKTWAA
ISTFEGEENAAGTVHQALKERTGLLTIIVPRHPERCDAIEAALVAKGLKVARRTRGDPVT
PEVDILLGDTIGEMGLYLRLTEVAFVGRSLFAEGGQNPLEPAMLGCAVLSGGNVQNFRET
YQMLAKNGSAKFVRDTEMLAKGVNYLLANDDMRRSMINAGLETVQQMRGALTATMKGLDP
YINPLVVKARLEPRPEA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgcgcgcaaggctggcactttccggctatcgctggctcggaacggccgtc
tatcccttcttctggtcctatcttgcgctccgcgcggcgaagggcaaggaggacccggca
cgccggcgcgaacgctatggctatgccagtgcgccgcgtccccagggccctctcgtctgg
tttcacgccgccagtgtcggagagacgaatgcagtcactccgctgatcaaggagatccgc
cgccgcggcatcgccgtggtgctgaccaccggtacgacgacctcggcgcgggtcgccgca
gagcgattgggctcggccgtcgtgcaccagtatgtgccgctcgatttcaagccggcggtg
agccgtttcctggaatattggcagccggatctggcgatcatcgcagaatcggaaatctgg
ccgatgacgatcatcgagctcggccggcgccatattccgcaggttctggtcaatggccgc
ctttccgaccgcaccttcgcccgatggaggcgccggccgtcgcttgccgatgctctcttc
gaaaatctcgcgctcgtcatcgctcaatccgatgtcgacgcggagcgtttccgcacgctc
ggtgcgctcccggtcaccgtctccggcaacctcaaggtggacaacgaggcgccgccgcac
gatccccgggacctgcgcgaataccgccagcagatcggtgcgcgaaagacctgggctgcg
atctcgaccttcgagggtgaggagaatgcggccgggacggtccaccaggcgctgaaggag
agaaccgggctgctgacgatcatcgttcctcgccatccggagcgttgcgacgcgatcgag
gctgccctggtcgcgaaggggttgaaggtcgcgcgccgcacgcgcggcgatccggtcaca
cctgaagtcgacattctactcggggatacgatcggcgagatggggctctatctgaggctg
acggaagtcgctttcgtcggacgttcgctattcgccgagggcggccagaacccgctcgag
ccggcaatgctcggctgcgcggtgctttccggcggaaacgttcagaatttccgcgagacc
taccagatgctcgccaagaacggcagcgccaagttcgtgcgcgatacggagatgctcgcc
aagggcgtcaactacctgctcgccaacgacgacatgcgtcgctcgatgatcaatgccgga
ctcgaaaccgtgcaacagatgcggggcgcgctgacggcgacgatgaaggggctcgatcct
tacatcaacccgctggtggtgaaggcgcggctggagccgcgccctgaagcctga

DBGET integrated database retrieval system