KEGG   Sinorhizobium meliloti 1021: SMc01005Help
Entry
SMc01005          CDS       T00058                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00790  Folate biosynthesis
sme01100  Metabolic pathways
Module
sme_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMc01005 (folE)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SMc01005 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-GeneID: 1233073
NCBI-ProteinID: NP_385526
RhizoBase: SMc01005
UniProt: Q92QB4
Position
complement(1531837..1532451)
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPVLDDTGRPTQKEAEEAVRVLLRWAGEDPAREGLKDTPSRVAKAYREIFGGY
DLVAEDVLGRTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKI
ARVVDIYARRLQTQEAMTAQIAKAIDETLMPRGVAVMIEAEHLCMAMRGIKKQGATTLTT
TFTGAFKSEPAEQVRFMTMLRGFK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatagtgaagaattttcctgtgctcgacgacacaggtcgtccgacgcagaag
gaagccgaagaagccgttcgcgtcttgttgcgctgggcaggtgaagatccggcacgagaa
ggcctgaaggacacgccttcgcgtgtcgccaaggcgtatcgggaaattttcggcggctac
gatctcgtggcggaagacgtgctcgggcgaaccttcgaggaagtctccggctacgacgat
atcgtgctcgaaaaggacatcccgttctattcgcattgcgagcaccacatggtgccgatc
atcggcaaggcccatatcgcctatctgccgaacggccgcgtgctcggcctttccaagatc
gcccgggtcgtcgatatctacgcccgtcgcctgcagacgcaggaagcgatgacggcgcag
atcgcaaaggccatcgacgagaccctcatgccccggggcgtggcggtgatgatcgaggcc
gagcacctgtgcatggcgatgcgcggtatcaagaagcagggcgcgacgacgcttacgacc
accttcaccggtgcgttcaagagcgagccggccgaacaggtccgcttcatgacgatgctc
aggggcttcaagtaa

DBGET integrated database retrieval system