KEGG   Sinorhizobium meliloti 1021: SMc01023Help
Entry
SMc01023          CDS       T00058                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00010  Glycolysis / Gluconeogenesis
sme00051  Fructose and mannose metabolism
sme00562  Inositol phosphate metabolism
sme00710  Carbon fixation in photosynthetic organisms
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01200  Carbon metabolism
sme01230  Biosynthesis of amino acids
Module
sme_M00002  Glycolysis, core module involving three-carbon compounds
sme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMc01023 (tpiA)
   00051 Fructose and mannose metabolism
    SMc01023 (tpiA)
   00562 Inositol phosphate metabolism
    SMc01023 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SMc01023 (tpiA)
Enzymes [BR:sme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SMc01023 (tpiA)
Exosome [BR:sme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SMc01023 (tpiA)
  Exosomal proteins of bladder cancer cells
   SMc01023 (tpiA)
  Exosomal proteins of melanoma cells
   SMc01023 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1233091
NCBI-ProteinID: NP_385544
RhizoBase: SMc01023
UniProt: Q92QA1
Position
1548277..1549047
Genome map
AA seq 256 aa AA seqDB search
MTPDIRPLVAGNWKMNGTRASLDQIKAMAEGVKGDLSARVDALICPPATLLYVATALCDD
SPLMIGAQDCHQKQSGAHTGEVSAEMVADCFGTHVIVGHSERRTDHGEGDALVRAKTEAA
HGADLVAIVCVGETEEERKAGRTLDILKRQLSESLPDQATAENTVIAYEPVWAIGTGLTP
TVSDVEEAHAFMRRELVSRFGAEGGKMRILYGGSVKPSNAKELMGVANVDGALIGGASLK
ADDFLAIYRAYEELTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatatccgcccgctcgtcgccggcaactggaagatgaatggaacacgtgcg
tctctggaccagatcaaggcaatggccgagggcgtcaaaggcgacctttccgcgagggtt
gacgccctgatctgcccgcccgccacattgctttacgttgcgaccgcgctttgcgacgac
agccctttgatgatcggggcgcaggactgccaccagaaacagtcgggagcccataccggc
gaagtctcggctgaaatggtcgccgattgcttcggcacgcatgtgatcgtcggccattcc
gaacggcgcaccgatcatggcgaaggcgacgcactggtgcgtgccaagacggaggccgcg
catggagcggatctcgtcgcgatcgtttgcgtcggtgagacggaagaggagcgcaaggcc
ggccggacgctcgatattctgaagcgccagctctccgagagcctgccggatcaggcgacg
gccgaaaataccgtgattgcctacgaacccgtgtgggcgatcggcaccggcctgacgccc
accgtgtccgacgtcgaggaggcgcacgccttcatgcgccgcgagctcgtctcgcgcttc
ggcgcggaaggcggcaagatgcgcatcctctatggaggttccgtcaagccctcgaatgcg
aaggaactcatgggcgttgccaatgtcgacggcgccctgatcggcggcgcgagcttgaaa
gccgatgatttcctcgccatctacagggcctatgaagaattgactgcctga

DBGET integrated database retrieval system