KEGG   Sinorhizobium meliloti 1021: SMc01153Help
Entry
SMc01153          CDS       T00058                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00071  Fatty acid degradation
sme00280  Valine, leucine and isoleucine degradation
sme00281  Geraniol degradation
sme00310  Lysine degradation
sme00360  Phenylalanine metabolism
sme00362  Benzoate degradation
sme00380  Tryptophan metabolism
sme00410  beta-Alanine metabolism
sme00627  Aminobenzoate degradation
sme00640  Propanoate metabolism
sme00650  Butanoate metabolism
sme00903  Limonene and pinene degradation
sme00930  Caprolactam degradation
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01212  Fatty acid metabolism
Module
sme_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SMc01153
   00650 Butanoate metabolism
    SMc01153
  Lipid metabolism
   00071 Fatty acid degradation
    SMc01153
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMc01153
   00310 Lysine degradation
    SMc01153
   00360 Phenylalanine metabolism
    SMc01153
   00380 Tryptophan metabolism
    SMc01153
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMc01153
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMc01153
   00281 Geraniol degradation
    SMc01153
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMc01153
   00627 Aminobenzoate degradation
    SMc01153
   00930 Caprolactam degradation
    SMc01153
Enzymes [BR:sme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMc01153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 1232000
NCBI-ProteinID: NP_384472
RhizoBase: SMc01153
UniProt: Q52995
Position
397173..397946
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKA
FAAGADIKEMQGLDFVDGYLADFLGGWEHVANARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVV
APDRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQK
EGMAAFVAKRKAEFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgttgctggtcgaaacgcagggccgcgtgggcctgatcacgctcaac
cgtccgcaggcgctcaatgcgctgaatgcggtgctgatgcgcgagctcgatgccgcgctg
aaggccttcgacgccgacagggccgtcggcgccatcgtccttgccggctccgagaaggcc
tttgccgccggcgccgacatcaaggagatgcaggggctcgatttcgtcgacggttacctc
gccgatttccttggcggctgggagcatgtcgcgaacgcccgcaaaccgatgatcgccgcc
gtatccggtttcgcgctcggcggtggctgcgagctcgccatgatgtgcgacttcatcatc
gcctccgaaacggcgaagttcggccagccggagattacgcttggcgtcattcccggcatg
ggtggatcgcagcgcctgacccgcgcagtcggcaaggcgaaggccatggacctcattctc
accggccgcatgatggacgcggcggaggcggagcgctccgggctggtttcgcgcgtggtg
gctccggacaggctcctggaggaggcgctcggcgccgcggagaagatcgcgtcattctcg
ctgccggcggcgatgatggccaaggaggccgtcaaccgctctctggaactgacgctcgcc
gagggcctgcgcttcgagcggcggctcttccagtcgcttttcgcaacggaggaccagaaa
gagggcatggccgccttcgtcgccaagcgcaaagccgaattcaaacacagatga

DBGET integrated database retrieval system