KEGG   Sinorhizobium meliloti 1021: SMc01154Help
Entry
SMc01154          CDS       T00058                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sme03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
396210..397115
Genome map
AA seq 301 aa AA seqDB search
MPELPEVETVKRGLAPTMEGALLVRAELRRPDLRFPFPENFANAVAGRRIIALSRRAKYL
MIELEGGDVIIAHLGMSGSFRIEKGPIEAGADPATPGAFHHPRGKDEKHDHVVFHLDGGS
GPARVIYNDPRRFGFMDLARRSALADHVFLRGLGEEPTGNALDAAYLATRFAGKIQPLKA
ALLDQRTIAGLGNIYVCEALWRSGLSPKRSAGTLVDKRGRPKQALIALTERIRAVIADAI
AAGGSSLKDHIQADGSLGYFQHSFSVYDREGEACRTPGCHGTVARIVQAGRSTFYCPHCQ
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgcccgaggtggaaacggtcaagcgcggactggcgccgacgatggagggt
gcgcttctggtgcgggcggagttgcgccggccggatctgcgctttccgttccccgagaat
ttcgcgaacgcggtcgcgggccgccggatcatcgccctctcgcggcgcgccaaatatctg
atgatcgagctcgagggcggcgacgtcatcatcgcccatctcggcatgtccggctcgttc
cggatcgagaagggcccgatagaggctggtgcggatccggccacgcccggcgctttccac
cacccgcgcggcaaggacgagaagcacgatcatgtcgtcttccatctcgatggcggctcc
gggccggcacgggtgatctataacgatccgcgtcgcttcggtttcatggatctggcacgg
cgctctgcgctcgccgaccacgtcttcctccgcggcctcggcgaggagccgaccggcaat
gccctcgatgccgcctatctcgccacccgtttcgccggcaagatccagccgctgaaagcc
gctcttctcgaccagaggacgatcgcggggctcggaaatatctatgtttgcgaggcgctg
tggcgctcgggcctctcgccgaaaaggtcggcaggcacgctcgtcgacaagcggggccgc
ccgaaacaggcgctgatcgcgctgacggaaaggatccgcgccgtgattgccgatgcgatc
gccgccggcggctcctcgctcaaggatcacattcaggcggacggcagtctcggctatttc
cagcacagcttctccgtctatgacagggaaggcgaggcttgccgcacgcccggctgccac
ggtacggtcgcccgcatagtacaggcgggacgttcgactttttactgtccgcactgccag
aaatag

DBGET integrated database retrieval system