KEGG   Sinorhizobium meliloti 1021: SMc01442Help
Entry
SMc01442          CDS       T00058                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sme00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sme00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2286901..2287443)
Genome map
AA seq 180 aa AA seqDB search
MTTRPKIVFVVAVAANGIIGREGDLPWRLSTDLKRFKALTIGKPVVMGRKTWASLGRPLP
GRPNIVISRNPDFEAPGAEVAPSLETALTIARERAAAVGADEICIIGGGEIYRQSIGMAD
VLHVTEVQAEVDGDTRFPSIDPATFEKVMEEDLPRSEKDSHAMHFVTWRRRTPPPEGAGA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgaccgaagatcgttttcgtcgtcgctgtcgcggcgaatggaataatcggc
cgcgagggcgatctgccctggcggctttcgaccgatctcaagcgcttcaaggcgctgacg
atcggcaagccggtcgtcatgggacggaagacctgggcctcgctcgggcggcccttgccc
ggcaggccgaacatcgtcatcagccgcaaccccgatttcgaggctcccggcgcggaggtg
gcgccgtcgcttgaaacggcgctcacgatcgcgcgggagcgggcggccgcggtcggggcc
gacgagatttgcatcattggcggcggcgagatctaccgtcagtcgatcggcatggccgat
gtgctgcacgtgaccgaagtgcaggcggaggtggatggcgatacgcgcttcccttctatc
gacccggcgactttcgagaaggtgatggaggaagatcttccgcgcagcgagaaagacagt
cacgcaatgcatttcgtgacctggcgccgccgcacgccgccgccggaaggtgcgggagcc
tga

DBGET integrated database retrieval system