KEGG   Sinorhizobium meliloti 1021: SMc01613Help
Entry
SMc01613          CDS       T00058                                 

Gene name
rpiB
Definition
ribose-5-phosphate isomerase B (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMc01613 (rpiB)
   01230 Biosynthesis of amino acids
    SMc01613 (rpiB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SMc01613 (rpiB)
   00051 Fructose and mannose metabolism
    SMc01613 (rpiB)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SMc01613 (rpiB)
Enzymes [BR:sme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SMc01613 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2404360..2404797)
Genome map
AA seq 145 aa AA seqDB search
MKIAIGADSAGKPLLDVIAAHLAKRSDLEVKDLSQTGYYADLSRDLAQTITAGENERGIL
ICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTW
LASEFDPNGPSAANVEAIDRLDQAK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcgattggagccgacagcgccggcaagcccctgctcgacgtcatcgccgcg
catctcgccaagagaagcgatctcgaagtcaaggacctgagtcagaccggctactatgcc
gatctctcccgcgatctggcgcagacgatcacggccggcgaaaacgaacgcggtattctg
atctgcggcaccggcatcggcgtgtgcatctcggccaacaaggtgcccggcatccgcgcc
gcgctgacccacgacacctattccgccgagcgggcggccaaatccaacaacgcccagatc
atcaccatgggcgcgcgcgtcatcggcccggaactggcgaaatcgatcgtcgatacgtgg
ctcgcctccgagttcgaccccaacggtccctcggcggcaaatgtcgaagcgatcgaccgc
ctggatcaggcgaagtaa

DBGET integrated database retrieval system