KEGG   Sinorhizobium meliloti 1021: SMc01613Help
Entry
SMc01613          CDS       T00058                                 

Gene name
rpiB
Definition
(RefSeq) ribose-5-phosphate isomerase B
  KO
K21911  
D-erythrulose 4-phosphate isomerase [EC:5.3.1.34]
Organism
sme  Sinorhizobium meliloti 1021
Brite
Enzymes [BR:sme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.34  D-erythrulose 4-phosphate isomerase
     SMc01613 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(2404360..2404797)
Genome map
AA seq 145 aa AA seqDB search
MKIAIGADSAGKPLLDVIAAHLAKRSDLEVKDLSQTGYYADLSRDLAQTITAGENERGIL
ICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTW
LASEFDPNGPSAANVEAIDRLDQAK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcgattggagccgacagcgccggcaagcccctgctcgacgtcatcgccgcg
catctcgccaagagaagcgatctcgaagtcaaggacctgagtcagaccggctactatgcc
gatctctcccgcgatctggcgcagacgatcacggccggcgaaaacgaacgcggtattctg
atctgcggcaccggcatcggcgtgtgcatctcggccaacaaggtgcccggcatccgcgcc
gcgctgacccacgacacctattccgccgagcgggcggccaaatccaacaacgcccagatc
atcaccatgggcgcgcgcgtcatcggcccggaactggcgaaatcgatcgtcgatacgtgg
ctcgcctccgagttcgaccccaacggtccctcggcggcaaatgtcgaagcgatcgaccgc
ctggatcaggcgaagtaa

DBGET integrated database retrieval system