KEGG   Sinorhizobium meliloti 1021: SMc01614Help
Entry
SMc01614          CDS       T00058                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
sme  Sinorhizobium meliloti 1021
Brite
Enzymes [BR:sme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     SMc01614 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(2404835..2405602)
Genome map
AA seq 255 aa AA seqDB search
MSKSGLWVGTSWKMNKTLAEAMVFADGLAAADDARDQRIQRFVIPPFTAARQVKERLKAT
SVKVGAQNMHWDDAGAWTGEISPVMLSDCDLDIVELGHSERREHFGETDRTVGLKTAAAV
KHGLVPLICIGETLAQREAGEADTVLKRQVEGAFAFLEGAARKAPVLLAYEPVWAIGVNG
IPATADYADARHRLIGEVAERALGVKVPVLYGGSVNPQNCEELILQPHIDGLFIGRSAWD
VGGYLDILQRVARAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtctggtctctgggtcggcacgagctggaagatgaacaagacgctggccgag
gcaatggtcttcgccgacggtcttgctgccgccgacgatgcgcgcgatcagcggatacag
cgcttcgtcattcctccgttcaccgccgcgcggcaggtgaaggaaaggcttaaggcgacg
agcgtcaaggtcggtgcgcagaacatgcactgggacgatgccggcgcctggaccggcgaa
atttccccggtcatgctgagcgattgcgatctcgacatcgtcgagctcggccacagcgag
cggcgggagcatttcggcgagaccgaccgcaccgtgggcttgaagacggcagccgccgtc
aagcatgggctcgtgccgttgatctgcatcggcgaaactctcgcgcaacgcgaagcgggc
gaggcggatactgtcctgaagcgccaggtggaaggcgcctttgcctttctcgaaggcgcg
gcgcggaaggcgcccgttcttctggcttacgagcccgtctgggcgatcggcgtcaacggc
ataccggcgaccgccgactatgcggacgcccgccatcgcctcattggcgaagtcgccgag
cgtgcactcggcgtgaaggttccggtgctctatggcggcagcgtcaatcctcagaactgc
gaggaattgatcctccaaccccatatcgacgggctcttcatcggccgctccgcctgggac
gtcggcggctatctcgacattttgcaacgcgtagcccgggcgatctga

DBGET integrated database retrieval system