KEGG   Sinorhizobium meliloti 1021: SMc01614Help
Entry
SMc01614          CDS       T00058                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMc01614 (tpiA)
   01230 Biosynthesis of amino acids
    SMc01614 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMc01614 (tpiA)
   00051 Fructose and mannose metabolism
    SMc01614 (tpiA)
   00562 Inositol phosphate metabolism
    SMc01614 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SMc01614 (tpiA)
Enzymes [BR:sme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SMc01614 (tpiA)
Exosome [BR:sme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SMc01614 (tpiA)
  Exosomal proteins of bladder cancer cells
   SMc01614 (tpiA)
  Exosomal proteins of melanoma cells
   SMc01614 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2404835..2405602)
Genome map
AA seq 255 aa AA seqDB search
MSKSGLWVGTSWKMNKTLAEAMVFADGLAAADDARDQRIQRFVIPPFTAARQVKERLKAT
SVKVGAQNMHWDDAGAWTGEISPVMLSDCDLDIVELGHSERREHFGETDRTVGLKTAAAV
KHGLVPLICIGETLAQREAGEADTVLKRQVEGAFAFLEGAARKAPVLLAYEPVWAIGVNG
IPATADYADARHRLIGEVAERALGVKVPVLYGGSVNPQNCEELILQPHIDGLFIGRSAWD
VGGYLDILQRVARAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtctggtctctgggtcggcacgagctggaagatgaacaagacgctggccgag
gcaatggtcttcgccgacggtcttgctgccgccgacgatgcgcgcgatcagcggatacag
cgcttcgtcattcctccgttcaccgccgcgcggcaggtgaaggaaaggcttaaggcgacg
agcgtcaaggtcggtgcgcagaacatgcactgggacgatgccggcgcctggaccggcgaa
atttccccggtcatgctgagcgattgcgatctcgacatcgtcgagctcggccacagcgag
cggcgggagcatttcggcgagaccgaccgcaccgtgggcttgaagacggcagccgccgtc
aagcatgggctcgtgccgttgatctgcatcggcgaaactctcgcgcaacgcgaagcgggc
gaggcggatactgtcctgaagcgccaggtggaaggcgcctttgcctttctcgaaggcgcg
gcgcggaaggcgcccgttcttctggcttacgagcccgtctgggcgatcggcgtcaacggc
ataccggcgaccgccgactatgcggacgcccgccatcgcctcattggcgaagtcgccgag
cgtgcactcggcgtgaaggttccggtgctctatggcggcagcgtcaatcctcagaactgc
gaggaattgatcctccaaccccatatcgacgggctcttcatcggccgctccgcctgggac
gtcggcggctatctcgacattttgcaacgcgtagcccgggcgatctga

DBGET integrated database retrieval system