KEGG   Sinorhizobium meliloti 1021: SMc01766Help
Entry
SMc01766          CDS       T00058                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMc01766 (hemB)
Enzymes [BR:sme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SMc01766 (hemB)
Exosome [BR:sme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMc01766 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1312688..1313830)
Genome map
AA seq 380 aa AA seqDB search
MRRDALDGRKKCRRRVAGNAGFQPLKAHDKPPSRTIRKEGRGAMNDRTNLVDRITGHRRM
RRNRKADWTRRLVRENRLTVDDLIWPIFVVPGSGIVEPIDAMPGVNRMSVDKAVEAAKEA
AGLGIPAIATFPNIDMALRDETGSDSLNADNLINQATRAIKKAVPDIGIITDVALDPFTS
HGHDGILRGGEIVNDETVEAIARAAVIQADAGSDIIAPSDMMDGRIGAIREALDAACHQN
VGIMSYATKFASAFYGPYREAIGTGGLLKGDKKTYYIDPSNGTEAIRDAALDVEEGADML
MVKPGLPYLDICWRMKEAFGLPVFAYQVSGEYAQIKAAAANGWIDGERVMLETLLAFKRA
GCDGILSYFAVDVARILAKR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgatgcactcgacgggcggaagaaatgccgcaggcgggtggcgggcaatgcg
ggttttcaacccctgaaggcgcatgataaaccgccttcacgcacgatcaggaaagaggga
cgcggcgcgatgaacgacaggacaaatcttgtggacaggatcaccggacaccgccgcatg
cgccgcaatcgcaaggcggattggacgcgccggctggtccgggagaaccgcctgacggtg
gacgacctgatctggccgatcttcgtcgtgcccggcagcggcatcgtcgagccgatcgat
gcgatgccgggcgtcaaccgcatgagcgtcgacaaggcggtcgaggccgcgaaggaggcg
gccggcctcggcatcccggccatcgccaccttccccaatatcgacatggcgcttcgcgac
gagaccggatccgacagcctcaacgccgacaatctgatcaatcaggcgacgcgggcgatc
aagaaggccgtacccgacatcgggatcatcaccgatgtcgcgctcgacccgttcaccagc
cacgggcacgacggcatcctgcggggcggcgagatcgtcaacgacgagacggtggaggcg
atcgccagggcggcggtcattcaggccgacgccggctccgacatcatcgcgccctccgac
atgatggacgggcggatcggcgcgatccgcgaggcgctcgacgcggcctgccaccagaat
gtcggcatcatgtcctatgcgacgaaattcgcctccgccttctatggcccttatcgagag
gcgatcggcaccggcggcctgctcaagggcgacaagaagacctattacatcgatccgtcg
aacggtacggaggcgatccgcgatgcggcactcgatgtggaggaaggcgcggacatgctg
atggtgaagcccggcctgccctatctcgatatctgctggcggatgaaggaagccttcggc
ctgccggtcttcgcgtatcaggtttccggcgaatacgcgcagatcaaggcagccgccgcc
aatggctggatcgatggcgagcgggtgatgctggagacgctgctcgccttcaagcgggcg
ggttgcgacgggatcctcagctactttgccgtcgacgtggctcgaattctcgcgaaacgc
tga

DBGET integrated database retrieval system