KEGG   Sinorhizobium meliloti 1021: SMc01812Help
Entry
SMc01812          CDS       T00058                                 

Definition
cytochrome P450-like monooxygenase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SMc01812
  Amino acid metabolism
   00380 Tryptophan metabolism
    SMc01812
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SMc01812
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SMc01812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1357853..1359100)
Genome map
AA seq 415 aa AA seqDB search
MSIAPGITIDGPARRVSLDVRNPRFFRNPLPAYAALHAQCPAFFWEEPQQWFFAGYEQVN
SLLRDRRFGRQILHVATREELGMPEPKPHLKDFDALEAHSLLELEPPAHTRLRTLVNRAF
VSRQIEELRPEIEALSHAVIDGFEKDGETELLKTYAETIPVTIIARMLGIPVEAAPRLLD
WSHRMVKMYVFNPSLETEFDANNASAEFADYLKGIIAEKRTNPADDLLTHMITSEKDGER
LSDAELISTTVLLLNAGHEATVHQIGNAVRTILQSGLSPAELFSDEKATERTVEECLRFA
APLHIFQRYALMDIELENGIALRKGDKIGLMLGAANVDPRKFSSPDTFRPDRNEGANVSF
GAGLHFCIGAPLARLELQISLPILFRRLPGMRLKNEPPVKDAFHFHGLERLDLVW
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgcccccggtatcaccatcgacggccccgcccggcgcgtctcccttgacgtc
cgcaacccccgtttcttccgcaatccgctgccggcctacgcggcgctccatgcgcaatgt
ccggcctttttctgggaagagccgcagcagtggttctttgcgggctacgagcaggtgaac
agcctgttgcgcgaccgtcgcttcggccgacagatcctgcatgtcgcgacccgggaagaa
ctcggcatgccggagccgaaaccgcatctgaaagatttcgatgcactcgaggcgcactcg
ctgctcgaactggagcctccggcccatacgcggctgcgcacgctcgtcaaccgcgccttc
gtctcccgtcagatcgaagagctcaggccggaaatcgaggcgctctcgcatgcggtgatc
gacggcttcgagaaggatggcgagaccgagctgttgaagacctatgccgagacgatcccg
gtaaccatcatcgcgcggatgctcggcattccggtcgaagcggcgccgcgtctgctcgac
tggtcgcaccgcatggtgaagatgtacgtgttcaatcccagcctggaaacggagttcgac
gccaacaatgcatcggcggagttcgccgactacctgaaagggatcatagccgagaagcgg
acaaaccccgccgacgacctgctcacgcatatgatcacctcggagaaagacggcgagcgc
ctgtcggacgcggagctgatttcgaccacggtcctccttctgaatgcgggccacgaggcg
acggttcatcagatcggcaatgccgtgcgcacgatcctgcagtccggcctctcgcccgcc
gaacttttctcggacgagaaggcgacggagcgcaccgtggaggagtgtctgcgcttcgcc
gcgcccttgcacatcttccagcgctacgccctcatggatatcgagctggagaacggcatc
gccctcaggaaaggggacaagatcggcctgatgctgggggcggcgaacgtcgatccgcgc
aaattctcctctcccgatacgttcaggccggaccgcaacgaaggcgccaatgtttcgttc
ggcgccggcctgcacttctgcatcggcgcaccgctggcacggctggagttgcagatttcg
ctgccgatcctgttccgacggcttcccgggatgcggctcaagaacgagccgccggtcaag
gacgccttccactttcatggtctggagcggctcgatctggtctggtga

DBGET integrated database retrieval system