KEGG   Sinorhizobium meliloti 1021: SMc01952Help
Entry
SMc01952          CDS       T00058                                 

Gene name
cysQ
Definition
transmembrane protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sme00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2674288..2675064
Genome map
AA seq 258 aa AA seqDB search
MLDILETSALAAGQAILEIYRAGPAVTYKADASPVTDADHRAERIILADLAAAFPDIPIV
AEEEVAAGRVPDIAGKRFFLVDPLDGTKEFVERNSHFTVNIGLVENGAPVVGVVYAPALG
LIYSAAAGMAKKAVVEDGQVTGEWTTIGCRRCGDRPMALTSRWHNSPETISFLTDQGISD
HEAVGSSLKFCLLAEGIADIYPRFSRTMEWDTAAGDAILRSAGGETLTMAGNPLGYGKRN
QSDDSDFANPWFISRGKA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctggacatactggaaacatcggcactcgccgccggacaagccatcctggaaatttac
cgtgccggtccggctgtcacctacaaggctgacgcctcgcccgtgaccgatgcggaccat
cgtgccgagcggatcatccttgccgatctggcggccgcctttccggatattccgatcgtc
gcggaggaggaggtcgccgcaggtcgcgttcccgatatcgccggaaagcggttcttcctc
gtcgacccgctggacggcacgaaggaattcgtcgaacgcaacagccatttcaccgtgaat
atcgggctcgtagaaaacggtgcacccgtcgtcggtgtcgtctatgcaccggctctcggc
ctcatctattcggcggccgccggcatggcgaagaaggcggtggtcgaggatggacaggtc
acgggcgaatggaccaccatcggctgccgccgttgcggcgaccggccgatggcgcttacc
agccgctggcacaacagccccgagacgatctccttcctcaccgatcagggcatcagcgat
catgaggccgtcggctcatcgctgaagttttgcctgctggccgaaggcattgcggacatc
tatccgcgcttcagccggacgatggagtgggacaccgcggcgggcgacgcgatcctaagg
tcggcaggcggtgaaacactgacgatggcgggcaatccgcttggctacggcaagcgcaat
caatcggatgacagcgacttcgccaatccctggttcatctcgcgcggcaaggcgtga

DBGET integrated database retrieval system