KEGG   Sinorhizobium meliloti 1021: SMc01967Help
Entry
SMc01967          CDS       T00058                                 

Gene name
speB2
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMc01967 (speB2)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SMc01967 (speB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2689288..2690346)
Genome map
AA seq 352 aa AA seqDB search
MAWDEQKLNELKAKYGESHGGELFDPTFRKVADKIFTKSGTRLAPYSGIPTFLTAPHMPV
DADDPDFGNLQVAMIGVPMDLGVTNRPGSRFGPRALRAIERIGPYNHVLGCAPVHDLRVA
DIGDVPFRSRYRLEISHEDIEKRISQIVDAGVLPLSVGGDHSITHPILKAVGRKQPVGMI
HIDAHCDTGGAFDLTKFHHGGPFRNAVLDGVLDPTRVIQIGIRGSAEYLWEFSYESGMTV
IHAEEVTGLGIPAIIEKAKKIVGDGPTYLSFDVDSLDPSFAPGTGTPEVGGLTTREVLEL
IRGLKGVNLVGGDVVEVAPQYDTTTNTAHAGAQVLFEILSLMVFSPAVAGKG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggatgaacagaagctcaacgaattgaaggcgaaatatggcgagagccatggc
ggcgagctcttcgatccgaccttccgcaaggtcgcggacaagattttcacgaagagcggc
acgcggctggcgccctattccggcattccgacattcctgaccgcaccccacatgccggtc
gatgccgatgacccggatttcggcaatcttcaggtggcgatgatcggcgttcccatggat
ctcggcgtcaccaaccgcccgggttcgcgcttcggaccacgggcgctgcgcgcgatcgag
cggatcggcccctataatcacgtgctcggctgcgccccagtgcatgatctccgggtcgcc
gacatcggcgatgttcccttccgcagccgctaccggctcgaaatcagccacgaggacatc
gagaagcggatcagccagatcgtcgatgctggcgtcctgccgctctccgtcggcggcgac
cattcgatcacgcatccgatcctcaaggccgtgggcaggaagcagcccgtcggcatgatc
catatcgacgcgcattgcgataccggcggcgccttcgacctgaccaagttccaccatggc
ggcccattccgcaacgccgttctcgacggcgtgctcgacccgacacgcgtcatccagatc
ggcatccgcggctcggcggagtatctgtgggagttctcctacgagtccggcatgacggtc
attcatgcggaggaggtcaccggactgggtattccggcgatcatcgaaaaggcgaagaag
atcgtcggcgacggtccgacctatctctccttcgatgtcgacagcctcgacccgagtttc
gcgccgggcaccggtacgccggaagtcggaggtctgacgacgcgggaggttctggagttg
atccgcgggctgaagggcgtcaatctcgtcggcggcgacgtcgtcgaggtggcgccgcaa
tacgacacgaccaccaatacagcccatgccggcgcccaggtgctcttcgagatcctgagc
ctgatggtcttcagtccggccgttgccggcaagggctga

DBGET integrated database retrieval system