KEGG   Sinorhizobium meliloti 1021: SMc01967Help
Entry
SMc01967          CDS       T00058                                 

Gene name
speB2
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00330  Arginine and proline metabolism
sme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMc01967 (speB2)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SMc01967 (speB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 1234169
NCBI-ProteinID: NP_386607
RhizoBase: SMc01967
UniProt: Q92MV8
Position
complement(2689288..2690346)
Genome map
AA seq 352 aa AA seqDB search
MAWDEQKLNELKAKYGESHGGELFDPTFRKVADKIFTKSGTRLAPYSGIPTFLTAPHMPV
DADDPDFGNLQVAMIGVPMDLGVTNRPGSRFGPRALRAIERIGPYNHVLGCAPVHDLRVA
DIGDVPFRSRYRLEISHEDIEKRISQIVDAGVLPLSVGGDHSITHPILKAVGRKQPVGMI
HIDAHCDTGGAFDLTKFHHGGPFRNAVLDGVLDPTRVIQIGIRGSAEYLWEFSYESGMTV
IHAEEVTGLGIPAIIEKAKKIVGDGPTYLSFDVDSLDPSFAPGTGTPEVGGLTTREVLEL
IRGLKGVNLVGGDVVEVAPQYDTTTNTAHAGAQVLFEILSLMVFSPAVAGKG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggatgaacagaagctcaacgaattgaaggcgaaatatggcgagagccatggc
ggcgagctcttcgatccgaccttccgcaaggtcgcggacaagattttcacgaagagcggc
acgcggctggcgccctattccggcattccgacattcctgaccgcaccccacatgccggtc
gatgccgatgacccggatttcggcaatcttcaggtggcgatgatcggcgttcccatggat
ctcggcgtcaccaaccgcccgggttcgcgcttcggaccacgggcgctgcgcgcgatcgag
cggatcggcccctataatcacgtgctcggctgcgccccagtgcatgatctccgggtcgcc
gacatcggcgatgttcccttccgcagccgctaccggctcgaaatcagccacgaggacatc
gagaagcggatcagccagatcgtcgatgctggcgtcctgccgctctccgtcggcggcgac
cattcgatcacgcatccgatcctcaaggccgtgggcaggaagcagcccgtcggcatgatc
catatcgacgcgcattgcgataccggcggcgccttcgacctgaccaagttccaccatggc
ggcccattccgcaacgccgttctcgacggcgtgctcgacccgacacgcgtcatccagatc
ggcatccgcggctcggcggagtatctgtgggagttctcctacgagtccggcatgacggtc
attcatgcggaggaggtcaccggactgggtattccggcgatcatcgaaaaggcgaagaag
atcgtcggcgacggtccgacctatctctccttcgatgtcgacagcctcgacccgagtttc
gcgccgggcaccggtacgccggaagtcggaggtctgacgacgcgggaggttctggagttg
atccgcgggctgaagggcgtcaatctcgtcggcggcgacgtcgtcgaggtggcgccgcaa
tacgacacgaccaccaatacagcccatgccggcgcccaggtgctcttcgagatcctgagc
ctgatggtcttcagtccggccgttgccggcaagggctga

DBGET integrated database retrieval system