KEGG   Sinorhizobium meliloti 1021: SMc01981Help
Entry
SMc01981          CDS       T00058                                 

Definition
cytochrome C transmembrane protein
Orthology
K08738  
cytochrome c
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SMc01981
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMc01981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2705882..2706268
Genome map
AA seq 128 aa AA seqDB search
MRIALAALSFSALSLCPVAGLAQEGDAEAGATVFKKCATCHVIDKDQNKVGPSLQGVIGR
TAGTHADFKYSQAMIDAGKGGLVWDDATLAEYLRNPRAKVKGTKMVFPGLKKDEEIANVI
AYLKQHPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcacttgctgccctgtctttttcggcactctcgctctgtccggtcgccggg
ctcgcccaggagggcgatgccgaggccggcgccaccgtcttcaagaaatgcgccacctgt
cacgtgatcgacaaggaccagaacaaggtcggcccttcgctgcaaggcgtcatcggccgg
acggccggcacccatgctgacttcaaatattcgcaagccatgattgatgcgggcaagggt
ggcctcgtctgggacgacgcgacgctggccgaatatctccgtaatcccagggccaaggtc
aaaggcaccaagatggtattccccggcctcaagaaggacgaggagattgccaatgtgatc
gcctacctgaagcagcatcccaaatag

DBGET integrated database retrieval system