KEGG   Sinorhizobium meliloti 1021: SMc02062Help
Entry
SMc02062          CDS       T00058                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sme  Sinorhizobium meliloti 1021
Brite
Enzymes [BR:sme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SMc02062 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1655247..1655861
Genome map
AA seq 204 aa AA seqDB search
MALRLRSGGIVNHELLKAVEQTPRTLFAPPQYQDEVYSKRLIPLECGSFMEGCDMAVRLL
HCLNLKPGQRILEVGTGSGFTAAVMGRIAERVLTIDRYQTLVASAQKNLEKAGLRNVVVR
QADGSAGVPGEGTFDRILITAAFNSLPRTFSDHLVSGGTLLVPIMMSETHCRIVRVNRTG
SRFDREDLFDAPYLPIVPQVASFL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcggcttcgctcgggcggcatcgtcaatcatgagctgctgaaggctgtggag
cagacgccgcggacgctcttcgctccgccgcaataccaggacgaggtctactccaaacgg
ctcattccgctcgagtgcggttccttcatggagggctgcgacatggccgtccggctcctg
cactgtctcaatctcaagcctggccagcgcatactcgaggtcggaaccggcagcggcttt
accgcggccgtgatggggcggatcgccgagcgcgtgctgacgatcgacaggtatcagaca
ctcgtcgcatcggcgcagaaaaacctggagaaggcgggcctgcgcaacgtcgtcgtccgc
caggccgatggcagcgcaggagtgccgggcgagggcaccttcgaccggattctcattacc
gccgcattcaacagccttccccggacgttctccgatcatctcgtttcgggcggcaccctg
ctggtgccgatcatgatgagcgaaacgcattgccgcatcgttcgcgtcaaccgtaccggt
agccgcttcgaccgggaagatctgttcgacgcgccttacctcccgatcgtcccacaggta
gcgtcgttcctttag

DBGET integrated database retrieval system