KEGG   Sinorhizobium meliloti 1021: SMc02083Help
Entry
SMc02083          CDS       T00058                                 

Definition
methyltransferase (PCM-like) transmembrane protein (EC:2.1.1.-)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sme  Sinorhizobium meliloti 1021
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1628736..1629395
Genome map
AA seq 219 aa AA seqDB search
MNFEAARIKMVDNQIRTTDVTSHSVLSAFLSVPREEFVPAKMRELAYIDTDIELVGGSQP
RYLMEPSPLAKLLQLAEISKSDLVLEIGCGTGYASALLSLLAGSVVALESDEALAATATA
TLTRLGYDNVAVVSGDLTKGYAAEAPYDVIFIDGAVEMLPAELFEQLRDGGRLVAVEGFG
NASRAKLYVRESGMTSERADFNTAVKPLPGFRRDRSFVF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagcagcccgcatcaagatggtggacaatcagatccggaccacggatgtg
acctcccattcagtcctgtctgctttcctgtcggtcccgcgtgaggagttcgtgcctgcc
aagatgcgggagctggcctatatcgacaccgatatcgagctcgtcggcggttcccagccg
cgttacctgatggagccgtcgccgttggcaaagctcctccagctcgcggagatctccaaa
tcggatctggtcctcgagatcggctgcgggacaggttacgcctcggccctgctttcgctt
ctcgccggttccgtcgtggcgctggagagcgacgaagccctggccgccacggccacggca
acgctgacacgcctcggttacgacaacgtcgccgtggtgagcggcgatctgaccaaggga
tatgcggcggaagcgccctacgacgtcatcttcatcgacggtgccgtcgagatgctccct
gccgagctgttcgagcagcttcgcgacggcggccggctcgtggccgtggaaggttttggt
aacgcatctcgtgcgaaactttacgtgcgcgaatcgggcatgacgtccgagcgagctgac
ttcaacaccgccgtgaagccgcttcccggcttccgccgcgaccgttcttttgttttttga

DBGET integrated database retrieval system