KEGG   Sinorhizobium meliloti 1021: SMc02083Help
Entry
SMc02083          CDS       T00058                                 

Definition
(RefSeq) methyltransferase (PCM-like) transmembrane protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sme  Sinorhizobium meliloti 1021
Brite
Enzymes [BR:sme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SMc02083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 Methyltransf_24 MTS Methyltransf_32 Methyltr_RsmB-F Methyltransf_23 TehB Methyltransf_4 Methyltransf_3 PrmA
Motif
Other DBs
NCBI-GeneID: 1233166
NCBI-ProteinID: NP_385619
RhizoBase: SMc02083
UniProt: Q92Q39
Position
1628736..1629395
Genome map
AA seq 219 aa AA seqDB search
MNFEAARIKMVDNQIRTTDVTSHSVLSAFLSVPREEFVPAKMRELAYIDTDIELVGGSQP
RYLMEPSPLAKLLQLAEISKSDLVLEIGCGTGYASALLSLLAGSVVALESDEALAATATA
TLTRLGYDNVAVVSGDLTKGYAAEAPYDVIFIDGAVEMLPAELFEQLRDGGRLVAVEGFG
NASRAKLYVRESGMTSERADFNTAVKPLPGFRRDRSFVF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagcagcccgcatcaagatggtggacaatcagatccggaccacggatgtg
acctcccattcagtcctgtctgctttcctgtcggtcccgcgtgaggagttcgtgcctgcc
aagatgcgggagctggcctatatcgacaccgatatcgagctcgtcggcggttcccagccg
cgttacctgatggagccgtcgccgttggcaaagctcctccagctcgcggagatctccaaa
tcggatctggtcctcgagatcggctgcgggacaggttacgcctcggccctgctttcgctt
ctcgccggttccgtcgtggcgctggagagcgacgaagccctggccgccacggccacggca
acgctgacacgcctcggttacgacaacgtcgccgtggtgagcggcgatctgaccaaggga
tatgcggcggaagcgccctacgacgtcatcttcatcgacggtgccgtcgagatgctccct
gccgagctgttcgagcagcttcgcgacggcggccggctcgtggccgtggaaggttttggt
aacgcatctcgtgcgaaactttacgtgcgcgaatcgggcatgacgtccgagcgagctgac
ttcaacaccgccgtgaagccgcttcccggcttccgccgcgaccgttcttttgttttttga

DBGET integrated database retrieval system