KEGG   Sinorhizobium meliloti 1021: SMc02170Help
Entry
SMc02170          CDS       T00058                                 

Definition
(RefSeq) ABC transporter permease
  KO
K10553  fructose transport system permease protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Module
sme_M00218  Fructose transport system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SMc02170
Transporters [BR:sme02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Fructose transporter [MD:M00218] [OT]
    SMc02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-GeneID: 1232112
NCBI-ProteinID: NP_384583
RhizoBase: SMc02170
UniProt: Q7APG0
Position
525199..526281
Genome map
AA seq 360 aa AA seqDB search
MGETNTAAQPSQEFEKVLADSSTDVASFDAHDKTLLQKLQHFLHSSPAAVPLIVLVLSLI
AFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIMVLSSVIMGQF
TFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLASNFLYSANET
IRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWYVLNRTAWGRYVYAVGDD
PEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTAGQFANIESITAVVIGG
ISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVAIDQWIRKVAA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacaaacacagccgcacagccatcccaggaattcgaaaaggtcctggccgac
agttcgacggacgtagcgtcattcgacgcgcatgataagacgctgcttcagaagctgcag
cacttcctgcattcgagcccggccgcggtgccgctgatcgtgctggtcctgtcgctgatc
gccttcggggtcattctcggcggcaagttcttttccgccttcaccatgacgctgatcctg
cagcaggtggcgatcgtcggtatcgtcggtgccgctcagacgctcgtgatcctgaccgcc
ggtatcgatctttcggtcggcgccatcatggtgctctcgtccgtcatcatggggcagttc
accttccgctacggcttcccgccggcgctctccgtcatctgcggccttggggtgggggcg
ctttgcggctacatcaacggaacgctcgtcgcgcgcatgaagctgccgccctttatcgtc
acgctcggcatgtggcagatcgtgctcgcctcgaacttcctctattccgccaatgagacg
atccgggctcaggacatttccgcgaatgcctcgatcctgcagttcttcggccagaacttc
cgcatcggcaatgccgtcttcacctacggcgtcgtggtgatggtgctcctcgtctgcctt
ctttggtatgtcctgaaccgcaccgcctgggggcgctatgtctatgccgtcggcgacgac
cccgaggctgccaagctcgccggcgtcaacgtcacgcgcatgctcatctccatctatacg
ctctccggcctcatctgcgcccttgccggctgggccctcatcggccgcatcggctcagtc
tccccgacagcgggccagtttgcgaatatcgaatcgatcactgccgtggtgatcggcggc
atctcgctcttcggcggccgcggctccatcatgggcatgctcttcggcgcgctgatcgtc
ggcgtcttctcgctcggcctgcgcctcatgggcaccgacccgcaatggacctatctcctg
atcggcttgctgatcatcatcgccgttgcaatcgaccagtggatcagaaaggtagcagcc
tga

DBGET integrated database retrieval system