KEGG   Sinorhizobium meliloti 1021: SMc02170Help
Entry
SMc02170          CDS       T00058                                 

Definition
(RefSeq) ABC transporter permease
  KO
K10553  
fructose transport system permease protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
ABC transporters
Module
Fructose transport system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SMc02170
Transporters [BR:sme02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Fructose transporter [MD:M00218] [OT]
    SMc02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
525199..526281
Genome map
AA seq 360 aa AA seqDB search
MGETNTAAQPSQEFEKVLADSSTDVASFDAHDKTLLQKLQHFLHSSPAAVPLIVLVLSLI
AFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIMVLSSVIMGQF
TFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLASNFLYSANET
IRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWYVLNRTAWGRYVYAVGDD
PEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTAGQFANIESITAVVIGG
ISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVAIDQWIRKVAA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacaaacacagccgcacagccatcccaggaattcgaaaaggtcctggccgac
agttcgacggacgtagcgtcattcgacgcgcatgataagacgctgcttcagaagctgcag
cacttcctgcattcgagcccggccgcggtgccgctgatcgtgctggtcctgtcgctgatc
gccttcggggtcattctcggcggcaagttcttttccgccttcaccatgacgctgatcctg
cagcaggtggcgatcgtcggtatcgtcggtgccgctcagacgctcgtgatcctgaccgcc
ggtatcgatctttcggtcggcgccatcatggtgctctcgtccgtcatcatggggcagttc
accttccgctacggcttcccgccggcgctctccgtcatctgcggccttggggtgggggcg
ctttgcggctacatcaacggaacgctcgtcgcgcgcatgaagctgccgccctttatcgtc
acgctcggcatgtggcagatcgtgctcgcctcgaacttcctctattccgccaatgagacg
atccgggctcaggacatttccgcgaatgcctcgatcctgcagttcttcggccagaacttc
cgcatcggcaatgccgtcttcacctacggcgtcgtggtgatggtgctcctcgtctgcctt
ctttggtatgtcctgaaccgcaccgcctgggggcgctatgtctatgccgtcggcgacgac
cccgaggctgccaagctcgccggcgtcaacgtcacgcgcatgctcatctccatctatacg
ctctccggcctcatctgcgcccttgccggctgggccctcatcggccgcatcggctcagtc
tccccgacagcgggccagtttgcgaatatcgaatcgatcactgccgtggtgatcggcggc
atctcgctcttcggcggccgcggctccatcatgggcatgctcttcggcgcgctgatcgtc
ggcgtcttctcgctcggcctgcgcctcatgggcaccgacccgcaatggacctatctcctg
atcggcttgctgatcatcatcgccgttgcaatcgaccagtggatcagaaaggtagcagcc
tga

DBGET integrated database retrieval system