KEGG   Sinorhizobium meliloti 1021: SMc02464Help
Entry
SMc02464          CDS       T00058                                 

Gene name
sdhD
Definition
succinate dehydrogenase membrane anchor subunit protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:sme01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sme00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sme00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:sme00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3333477..3333857)
Genome map
AA seq 126 aa AA seqDB search
MNMRTPLGKVRGLGSAKEGTDHFWRQRLTAVASIPLTIFFVVFLAHYAGAPHAELIAALS
NPFVAVTMGLMVVAGLVHMKIGMQVIIEDYVHGEGAKIALLMLNTFFTIAVGGLCLFAVL
KIAFAG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgcacacctctcggcaaggtccggggtctcggttcggcaaaggaaggcacg
gatcacttctggcggcagcgcctcacggccgtcgccagcattcctctcacgatcttcttc
gtcgtctttctcgcccattatgcgggcgcaccgcatgcggaactgatcgcggccctttcg
aacccgttcgtggcggtgaccatgggtctgatggtcgtcgccggcctcgttcacatgaag
atcggcatgcaggtcatcatcgaggactacgtccatggggagggcgccaagatagcgctt
ctcatgctcaacacattcttcacgatcgcggtcggcgggctctgtcttttcgccgtcctg
aagatcgcatttgcagggtaa

DBGET integrated database retrieval system