KEGG   Sinorhizobium meliloti 1021: SMc02480Help
Entry
SMc02480          CDS       T00058                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00020  Citrate cycle (TCA cycle)
sme00640  Propanoate metabolism
sme00660  C5-Branched dibasic acid metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01200  Carbon metabolism
Module
sme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMc02480 (sucC)
   00640 Propanoate metabolism
    SMc02480 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SMc02480 (sucC)
Enzymes [BR:sme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SMc02480 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 1234739
NCBI-ProteinID: NP_387161
RhizoBase: SMc02480
UniProt: Q9EYG9
Position
complement(3317268..3318464)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLKSYGAPVAEGVAIFSADEAEAAAKKLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAKSVDEVVANAKDMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYL
SILVDRSVGQVAFVVSTEGGMDIEAVAEHTPEKIVTVAIDPEKGVTAENLKTLADALKLE
GEARADAEKLFPILYKAFVEKDMSLLEVNPLIVMTNGRMRVLDAKVSFDGNALFRHEDVV
ALRDTTEEDDKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTQAFKIITADPAVKGILVNIFGGIMKCDVIAEGVLAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaataccaggccaaggctctgttgaagagctatggcgcgccggtcgcg
gaaggcgtcgcgatcttctccgccgacgaggccgaggcggccgcgaagaagctgccgggg
ccgctttacgtggtgaagagccagatccacgccggcggccgcggcaagggcaagttcaag
gaactcggccccgatgcgaagggcggcgtgcgcctggccaagtcggtggacgaggtcgtc
gccaatgccaaggacatgctcggcaacacgctggtgaccaagcagaccggtccggccggc
aagcaggtcaaccgcctctatatcgaggacggcgccgatatcgaccgcgagctctatctc
tcgatcctcgtcgatcgctccgtcggccaggtggccttcgtcgtttcgaccgagggcggc
atggatatcgaagcggtcgccgaacatacgccggagaagatcgtcaccgttgcgatcgat
ccggaaaagggtgtgaccgcagagaatctgaagacgctggccgacgcgctgaagctcgaa
ggcgaagcgcgtgccgacgccgagaagctcttcccgatcctctacaaggcattcgtcgaa
aaggacatgagcctgctcgaggtcaatccgctgatcgtcatgacgaacggccggatgcgc
gtcctcgacgccaaggtctccttcgacggcaatgcgctcttccgccatgaggacgtggtc
gcgctgcgcgacacgacggaagaggacgacaaggaaatcgaggcgtcgaaatacgacctc
gcctatgtcgccctggacggcaatatcggctgtatggtcaacggcgccggtcttgccatg
gcgacgatggacatcatcaagctctacggcgccgagcccgcgaacttcctcgatgtcggc
ggcggcgcctcgaaggaaaaggtcacccaggccttcaagatcatcacggccgatccggcg
gtgaagggcatcctcgtcaacatcttcggcggcatcatgaaatgcgatgtcatcgccgag
ggcgtgctcgcagcggtcaaggaagtcggcctcaaggtgccgctcgtcgtgcgcctggaa
ggcaccaatgtcgagctcggcaagaagatcatcaatgaatcgggcctcaacgtgatttcc
gccgatgatctggacgacgccgcccagaagatcgttgcagccgtgaagggagcctga

DBGET integrated database retrieval system