KEGG   Sinorhizobium meliloti 1021: SMc02483Help
Entry
SMc02483          CDS       T00058                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMc02483 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMc02483 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SMc02483 (sucB)
Enzymes [BR:sme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SMc02483 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3311706..3312959)
Genome map
AA seq 417 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPAAGTLSEIV
AQAGETVGLGALLGQIAEGAGAAAAAPAAAEKKPEPAAATAAPAAAAQPAAAAATQTSTS
MPPAPAAAKLIAENNLSADQIDGSGKRGQVLKGDVLAAVAKGISAPAAAEPAKVQARAPA
PAEDAAREERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRSKYKDIFEKKH
GVKLGFMGFFTKAVTHALKELPAVNAEVDGTEIIYKNFCHVGVAVGTDKGLVVPVVRDAD
QMSIAEIEKEIGRLGKAARDGTLSMADMQGGTFTISNGGVYGSLMSSPILNAPQSGILGM
HKIQDRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaaatccgcgttcccacccttggcgaatccgtcagcgaagcgaccgtcggc
acctggttcaagaaggtcggcgacgcgatcaaggccgacgagccgatcctcgagctcgag
accgacaaggtgacgatcgaagttccggccccggccgccggcacgctcagcgaaatcgtc
gcgcaggcgggcgaaaccgtgggtctcggcgcgctgctcgggcagatcgccgagggcgcg
ggtgctgccgccgctgcgccggctgcggccgagaagaagcctgaacctgctgccgccacc
gctgctccggctgcggccgcacagccggccgccgctgccgcgacgcagacgtccacgtcg
atgccgccggccccggccgccgccaagctcatcgccgagaacaatctttccgccgatcag
atcgacggctcgggcaagcgcggccaggtgttgaagggtgacgtgctcgcggccgtcgcc
aagggcatttcggctccggctgcagccgaaccggccaaggtccaggcccgcgcgccggcg
ccggcggaagatgccgcccgcgaagagcgcgtgaagatgacccgcctgcgccagacgatc
gcccggcgtttgaaggacgcgcagaacaccgcggctatgctcaccacctataacgaggtg
gacatgagcgccgtcatgagcctgcgctcgaagtacaaggacatcttcgagaagaagcac
ggcgtgaagctcggcttcatgggcttcttcaccaaggccgtgacgcatgcgctgaaggag
ttgccggctgtcaacgccgaggtcgacggcaccgagatcatctacaagaacttctgccac
gtcggcgtcgccgtcggcaccgacaagggtctcgtcgtgccggtcgtgcgcgatgccgac
cagatgtcgatcgccgagatcgagaaggaaatcggccgtctcggaaaggcagcgcgcgac
ggtacgctgtccatggccgacatgcagggcggcaccttcaccatctccaacggcggcgtc
tacggttcgctgatgtcctcgccgatcctcaacgctccgcaatcgggcatcctcggcatg
cacaagatccaggaccgcccggtcgcgatcggcggtcaggtcgtcatccgcccgatgatg
tatctggcgctctcctacgatcaccgcatcgtcgacggcaaggaagcggtgaccttcctc
gtgcgcgtcaaggaaagcctcgaggatccggaacgcctggtgctggatctctag

DBGET integrated database retrieval system