KEGG   Sinorhizobium meliloti 1021: SMc02766Help
Entry
SMc02766          CDS       T00058                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMc02766 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMc02766 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMc02766 (trpB)
Enzymes [BR:sme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMc02766 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
28048..29268
Genome map
AA seq 406 aa AA seqDB search
MNQPPKPNSFRSGPDEEGRFGIFGGRFVAETLMPLILDLQDEWARAKNDPAFKAELENLG
THYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGNGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQILEAEGRLPDLVV
AAVGGGSNAIGIFHSFLDDEGVRIVGVEAGGKGLDGDEHCASLTAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaaccgcctaaaccgaactccttcaggtccggacccgatgaagagggccgtttc
ggcatattcggcgggcgcttcgtcgccgagacgctgatgccgctgatcctcgatctccag
gatgaatgggcgagggcgaagaacgatccggctttcaaggcggaactcgaaaatctcggc
acccactatatcggccggccgagcccgctctatttcgccgagcgcctgacggccgaactc
ggtggcgccaagatctatttcaagcgcgaggagctcaatcacacgggctcccacaagatc
aacaattgcatcggccagatcctgctcgccaagcgcatgggcaagacccgcatcatcgca
gaaaccggcgccggccagcacggagtggcatcggcgacggtcgcggcgcgcttcggcctg
ccctgcgtggtctacatgggtgcgaccgacgtggagcggcaggcgccgaacgtcttccgc
atgaagcttctcggcgccgaggtgaagccggtgaccgccggcaacggcaccctcaaggac
gccatgaacgaggcgttgcgcgactgggtgaccaatgtcgacagcacctattacctgata
ggcacggccgccggcccgcatccctatccggagatggtgcgcgacttccaggcagtcatc
ggtgaggaagccaagcagcagatcctcgaagccgaaggccggcttcccgatctcgtcgtc
gccgccgtcggcggcggttccaatgcgatcggcatcttccattcgttcctcgacgacgag
ggcgtcaggatcgtcggcgtcgaagcgggtggcaaggggctcgacggcgacgagcattgc
gcttcgctgaccgccggctcgcccggcgtgctccacggcaaccgcacctatcttcttcag
gacggtgacggccagatcaaggaaggccattcgatctcggccgggctcgattatcctggc
atcggaccggaacatgcctggctgaacgacatcggccgcgtcgaatatgtgccgatcatg
gatcatgaggcactcgaggcctttcagacgctgacgcggctcgaaggcatcatcccggcg
ctcgaaccgtcccatgcgcttgccgaagtcatcaagcgcgcgccgaaaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacattttcaccgtcggcaaa
attctcggtatggggcagtaa

DBGET integrated database retrieval system