KEGG   Sinorhizobium meliloti 1021: SMc02766Help
Entry
SMc02766          CDS       T00058                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00260  Glycine, serine and threonine metabolism
sme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01130  Biosynthesis of antibiotics
sme01230  Biosynthesis of amino acids
Module
sme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMc02766 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMc02766 (trpB)
Enzymes [BR:sme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMc02766 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Flavodoxin_1
Motif
Other DBs
NCBI-GeneID: 1231653
NCBI-ProteinID: NP_384134
RhizoBase: SMc02766
UniProt: Q92TC9
Position
28048..29268
Genome map
AA seq 406 aa AA seqDB search
MNQPPKPNSFRSGPDEEGRFGIFGGRFVAETLMPLILDLQDEWARAKNDPAFKAELENLG
THYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGNGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQILEAEGRLPDLVV
AAVGGGSNAIGIFHSFLDDEGVRIVGVEAGGKGLDGDEHCASLTAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaaccgcctaaaccgaactccttcaggtccggacccgatgaagagggccgtttc
ggcatattcggcgggcgcttcgtcgccgagacgctgatgccgctgatcctcgatctccag
gatgaatgggcgagggcgaagaacgatccggctttcaaggcggaactcgaaaatctcggc
acccactatatcggccggccgagcccgctctatttcgccgagcgcctgacggccgaactc
ggtggcgccaagatctatttcaagcgcgaggagctcaatcacacgggctcccacaagatc
aacaattgcatcggccagatcctgctcgccaagcgcatgggcaagacccgcatcatcgca
gaaaccggcgccggccagcacggagtggcatcggcgacggtcgcggcgcgcttcggcctg
ccctgcgtggtctacatgggtgcgaccgacgtggagcggcaggcgccgaacgtcttccgc
atgaagcttctcggcgccgaggtgaagccggtgaccgccggcaacggcaccctcaaggac
gccatgaacgaggcgttgcgcgactgggtgaccaatgtcgacagcacctattacctgata
ggcacggccgccggcccgcatccctatccggagatggtgcgcgacttccaggcagtcatc
ggtgaggaagccaagcagcagatcctcgaagccgaaggccggcttcccgatctcgtcgtc
gccgccgtcggcggcggttccaatgcgatcggcatcttccattcgttcctcgacgacgag
ggcgtcaggatcgtcggcgtcgaagcgggtggcaaggggctcgacggcgacgagcattgc
gcttcgctgaccgccggctcgcccggcgtgctccacggcaaccgcacctatcttcttcag
gacggtgacggccagatcaaggaaggccattcgatctcggccgggctcgattatcctggc
atcggaccggaacatgcctggctgaacgacatcggccgcgtcgaatatgtgccgatcatg
gatcatgaggcactcgaggcctttcagacgctgacgcggctcgaaggcatcatcccggcg
ctcgaaccgtcccatgcgcttgccgaagtcatcaagcgcgcgccgaaaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacattttcaccgtcggcaaa
attctcggtatggggcagtaa

DBGET integrated database retrieval system