KEGG   Sinorhizobium meliloti 1021: SMc02908Help
Entry
SMc02908          CDS       T00058                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SMc02908 (recR)
DNA repair and recombination proteins [BR:sme03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SMc02908 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
263174..263779
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCTDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGI
GPEDLNIRGLIDRVAKGGVRELIIAVNATVEGQTTAHYITDQLEGMEVRITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtccggaaatcgagaaactcatccagctcctggcgaaagtc
ccgggcctcgggccccgttccgcccgccgcgcggcgctgcatctcgtcaagaagaaggag
cagttgctcggcccccttgccgaggctatgggcgaagcccatcgtaaggtcaagatctgc
tcctgctgcggcaatgtcgacaccatcgacccctgcacggtctgcaccgacgaacggcgc
gaccaggcggtgatcatcgtggtcgaggacgtcgccgatctttgggcgctggagcgcgcc
ggcgccatgaatgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacggcatc
gggcctgaggatctgaacataaggggcctcatcgaccgcgtcgccaagggtggcgtgcgc
gagctgatcatcgccgtcaacgcgaccgtcgagggccagacgacggcgcactacatcacc
gatcaactcgaaggcatggaggtgagaatcacgcgcctcgcccatggcgtgcccgtcggc
ggcgagctcgactatctcgacgagggaacgctggccgccgcgcttagggcgagaacggtg
atttga

DBGET integrated database retrieval system