KEGG   Sinorhizobium meliloti 1021: SMc03091Help
Entry
SMc03091          CDS       T00058                                 

Gene name
argI1
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMc03091 (argI1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMc03091 (argI1)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SMc03091 (argI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3257061..3257984
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANH
PGANNLQSVAAFARALDEAVHDTARKGHFPIILGGDHALSMGSVSGMARHAQDVGRPLFV
LWLDAHADFNSPATSPSGNMHGMPVAFFCGEAEFAPILPKDRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPGVG
TTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcacattgatcggcgcacccatcgaggaaggctcgggccgccgcggcgca
gccatggggccgacggcgctcaggatcgccggcatagacacggtcctcgccgaactcggc
catacggtcaatgacgagggggatctgaggccgctgcccgcgcgcgatctcgccaaccat
cccggcgccaacaatctgcagtccgttgcagctttcgcgcgcgcgctcgacgaagccgtg
cacgataccgcgcgcaagggacatttccccatcattctcgggggcgaccacgcgctgtcg
atgggcagcgtctccggcatggcgcgtcacgcccaggacgtcggccggcccctcttcgtc
ctctggctcgacgcgcatgccgacttcaactcgcctgcgacctcgccctccggaaacatg
cacggcatgccggtcgccttcttctgcggcgaagcggagttcgccccgatccttccgaag
gaccggccgctggtcgacccgaagaaggtctatcaggtcggaatccgctcggtcgacgcg
cgtgagcgcgaggaaatcgccgagcacggcgtcaatgtcttcgatatgcgggccatcgac
gagatgggcatggcccacatcatccgtcagatcgtcgacgaggttcgcgccgccaacggc
ctgctgcatgtgagcctcgacgtcgatttcatggatccggaacttgcccccggcgtgggc
acgacggtcccgggcggcgcgaccttccgcgaggcgcacctcatcatggaagtgctgtgc
gacagcggcctcgtctcttccctcgatgtcgtcgagctcaacccgttcctcgacgaccgg
ggcaagagcgcgcgcattctggtcgaactgacggcaagcctcttcggccgccgtatcctt
gatcgtccgactcgcgcggcctga

DBGET integrated database retrieval system