KEGG   Sinorhizobium meliloti 1021: SMc03243Help
Entry
SMc03243          CDS       T00058                                 

Definition
alkaline phosphatase transmembrane protein (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sme00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sme00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sme02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3351886..3353448)
Genome map
AA seq 520 aa AA seqDB search
MAALRNTLTRRSFLFSAGAAGLVASSGLATPFYARGYGRPEFAHGVQSGDVDTGSGMIWT
RVDRPARVSVEYSTTESFSNAVRLADIDATPLTDCAVKCRLHNLLPDQDIFYRFIATDLY
DANRVSEPVVGRFRTAPLRRRSVRFVWSGDTAGQGWGIDEVGMKTYSTMRLHEPDFFIHS
GDTIYADNPIPDEIKLRDGGMWKNRIVTPEKRDVARTLEEYRGQWKYNLLDEHVRRLHAE
CPTFYQWDDHEVLNNWSASTDLSDDPRYPEKDVAVYAARAARAFHEMTAIRTLPTEPGRI
FRKIAYGPLLDVFFVDLRSYRGPNQEEGGGGLFGWRQADWLKRELAASSATWKVIACDMP
IGLIVWDDYSARRGSDAIADGDHGAPKGRESEFADLLRFVRDNAIENLVWLTADVHYTAA
HHYDPSRAAFKDFSPFWEFVSGPLHSGTYGPKELDMTFGPEVRFMKASGGGIDSNLPPSA
GLQFFGIVDISGQTRQMTVRLMDRQDQELWRVTLDPAVSA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ttggccgctcttcgaaacaccctcaccaggcgttctttcctcttctccgccggcgccgca
ggtcttgtcgcttcttccggtctcgccacgccgttctatgcgcgcggctacgggcggccg
gaattcgcccatggggtacagtccggcgacgtcgatacgggctcggggatgatctggacg
cgggtcgatcggccggcgcgcgtttccgtcgaatattcgaccacggaaagcttttcgaat
gccgtgaggcttgccgatatcgatgcgacgccgctgaccgactgcgccgtcaagtgccgg
ctccacaatctgctgccggaccaggacatcttctatcgcttcatcgcgaccgatctctac
gacgccaatcgcgtctccgaaccggtcgtcgggcgcttccggacggctcccttgcgccgc
cgctccgtgcgcttcgtctggtccggcgacacggcggggcagggctggggcatcgacgag
gtcggcatgaagacctattcgaccatgcggctgcacgagccggatttcttcatccattcc
ggcgacacgatctatgccgacaatcctatccccgacgagatcaagctgcgcgacggcggc
atgtggaagaaccggatcgtcacgcccgagaagcgagacgtcgcgcggacgctcgaggaa
tatcgcggccagtggaaatacaacctgctcgacgagcatgtgcggaggctccatgccgaa
tgtcccaccttctatcagtgggacgaccacgaggtcctgaacaactggtcggcctcgacc
gatctcagcgacgacccgcgctatccggagaaggatgtcgccgtctatgccgcccgcgcg
gcccgcgcgtttcacgagatgacggcgatccgcacgctgccgacggagcccggccgcatt
ttccgcaagatcgcctatggtccgctgctcgacgtcttcttcgtggatctgcgctcctat
cgcggccccaaccaggaagagggggggggcggcctcttcggctggcggcaggcggactgg
ctgaagcgcgagcttgcggcgtccagcgccacctggaaggtgatcgcctgcgacatgccg
atcggcctcatcgtttgggacgactattcggcaaggcgcggatcggatgccattgccgac
ggcgaccatggcgcgccgaaggggcgcgagagcgaatttgcggacctcctgcgcttcgtc
cgcgacaatgcgatcgagaacctcgtctggctgacggcggacgtgcattacacggcggcg
catcactacgatccctcgcgggctgccttcaaggacttctcgccgttctgggagttcgtc
tccgggccgcttcattccggcacctacggcccgaaggagctcgacatgaccttcggcccc
gaggttcgcttcatgaaggcgtccggcggaggaatcgacagcaacctgccgccgtcggcg
ggccttcaattcttcggcatcgtcgatatcagcggccagacgcggcagatgacggtgcgg
ctgatggaccggcaggatcaggaactctggcgggtaaccctcgatccggcggtttccgct
tga

DBGET integrated database retrieval system