KEGG   Sinorhizobium meliloti 1021: SMc03252Help
Entry
SMc03252          CDS       T00058                                 

Gene name
proB2
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMc03252 (proB2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMc03252 (proB2)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SMc03252 (proB2)
Enzymes [BR:sme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SMc03252 (proB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3366186..3367034)
Genome map
AA seq 282 aa AA seqDB search
MAPFSSLGESRSKMEDKFDLSSARLVVVKIGSTLVLDRETSGIRSSWLESLTEDVSRLLT
RGQQVVLVSSGAVAIGSTIVDRLATYSQVSHKQAAAALGQVQLTHAYSESLKRHGLQVAQ
LLMGRGDLVDPAHRLNTRAVLLRLIDLGAVPLVNENDTTATCGTRVGDNDRLAAWIAEII
NADLLILLSNVDGLFMKDPRNNPLTPMLTEVESITREIEAMATQSVDPYSSGGMISKIEA
GKIAMNAGCRMIIANGTRSHPLYAIESGGPSTHFIPVARDRV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccgttctcaagtcttggcgaatcaagatcgaagatggaagacaagtttgatttg
tcctcggcgcggcttgtggtggtaaagattggctctacgctcgttttagatagagagaca
agcggaatccgcagctcttggctcgagtcgttgacagaagacgtttcccgtcttcttaca
cgtgggcagcaggtggtcctagtttcgtccggcgccgtcgcgattggatcgactattgtc
gatcggcttgccacgtactcgcaagttagccacaagcaagctgcggccgcgcttggtcag
gttcaactaacacacgcttattcagaaagcttgaaacgtcacggattgcaggttgcgcag
ctgttgatgggtcgcggagatttggtcgatcctgcccatcgcctcaacacgcgggcagtc
cttttgcgcctcatcgaccttggcgctgtgccacttgttaatgagaatgatacgactgca
acctgcgggacccgagtgggcgataacgatcggttggcggcgtggatcgcggaaattatc
aacgccgaccttctcattctgctctccaacgtagatggcctcttcatgaaagatccgcgt
aataatccgttgacccccatgcttacagaggtggagtctattactcgcgagattgaggca
atggccactcaatcagttgatccctattcttcgggtggcatgatatcgaagatagaagca
ggcaagatagccatgaatgctggctgtagaatgattattgccaacggcacgagatctcac
ccgctttacgcaattgagagcggcgggccgtctacacatttcatccccgtcgcacgggat
agggtttga

DBGET integrated database retrieval system