KEGG   Sinorhizobium meliloti 1021: SMc03252Help
Entry
SMc03252          CDS       T00058                                 

Gene name
proB2
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sme01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sme00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3366186..3367034)
Genome map
AA seq 282 aa AA seqDB search
MAPFSSLGESRSKMEDKFDLSSARLVVVKIGSTLVLDRETSGIRSSWLESLTEDVSRLLT
RGQQVVLVSSGAVAIGSTIVDRLATYSQVSHKQAAAALGQVQLTHAYSESLKRHGLQVAQ
LLMGRGDLVDPAHRLNTRAVLLRLIDLGAVPLVNENDTTATCGTRVGDNDRLAAWIAEII
NADLLILLSNVDGLFMKDPRNNPLTPMLTEVESITREIEAMATQSVDPYSSGGMISKIEA
GKIAMNAGCRMIIANGTRSHPLYAIESGGPSTHFIPVARDRV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccgttctcaagtcttggcgaatcaagatcgaagatggaagacaagtttgatttg
tcctcggcgcggcttgtggtggtaaagattggctctacgctcgttttagatagagagaca
agcggaatccgcagctcttggctcgagtcgttgacagaagacgtttcccgtcttcttaca
cgtgggcagcaggtggtcctagtttcgtccggcgccgtcgcgattggatcgactattgtc
gatcggcttgccacgtactcgcaagttagccacaagcaagctgcggccgcgcttggtcag
gttcaactaacacacgcttattcagaaagcttgaaacgtcacggattgcaggttgcgcag
ctgttgatgggtcgcggagatttggtcgatcctgcccatcgcctcaacacgcgggcagtc
cttttgcgcctcatcgaccttggcgctgtgccacttgttaatgagaatgatacgactgca
acctgcgggacccgagtgggcgataacgatcggttggcggcgtggatcgcggaaattatc
aacgccgaccttctcattctgctctccaacgtagatggcctcttcatgaaagatccgcgt
aataatccgttgacccccatgcttacagaggtggagtctattactcgcgagattgaggca
atggccactcaatcagttgatccctattcttcgggtggcatgatatcgaagatagaagca
ggcaagatagccatgaatgctggctgtagaatgattattgccaacggcacgagatctcac
ccgctttacgcaattgagagcggcgggccgtctacacatttcatccccgtcgcacgggat
agggtttga

DBGET integrated database retrieval system