KEGG   Sinorhizobium meliloti 1021: SMc03798Help
Entry
SMc03798          CDS       T00058                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00010  Glycolysis / Gluconeogenesis
sme00052  Galactose metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMc03798 (galM)
   00052 Galactose metabolism
    SMc03798 (galM)
Enzymes [BR:sme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SMc03798 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1234874
NCBI-ProteinID: NP_387287
RhizoBase: SMc03798
UniProt: Q92L98
Position
3462915..3463931
Genome map
AA seq 338 aa AA seqDB search
MGTDTEIFGHLPSGEPVQRVTLKGGGLTASVITWGSVIQDLRLEGHAAPLVLGFENFESY
PAHSSYFGATPGRNANRIGAGRFALEGKAYQLELNESGATHLHGGSDNIAKRNWSIRRRA
EDSVTLEITDPDGRAGYPGNCTITCTYTLKPGGTLNVVYETETDAPTLANVCQHSYFNLD
GGSDAFGHDIMIAADHYLPTDERQIPTGEIRPVAGTAFDLREMTSLGRQLDGGGIAYDHN
FCLSPERVQKRSVALVRSINSGVSLEVLTTEPGVQLYTGEKLDVPVPGLEGRRYGPFAGF
CLETQIWPDAVNHEGFPKAVLRPGETLRQETDYVFTKN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagacacggaaatcttcggccacctgccctccggcgagcccgtacagcgcgtg
acgcttaagggcggcgggctgacggcgtcggtgatcacctggggctcggtcatacaggac
ctgcggctcgaaggacatgcagccccgctcgtgctcggcttcgagaatttcgaaagctat
ccggcccattcctcctatttcggcgccacccccggccgcaacgccaaccgcatcggcgcc
ggccgcttcgcgctcgaaggcaaggcctatcagctcgagctcaacgagagcggcgccacg
catctccacggcggcagcgacaatatcgccaagcgcaactggtcgatccgcaggcgggct
gaagacagcgtaacgctcgagatcaccgatccggacggccgtgccggctacccgggcaat
tgcacgatcacctgcacctatacgctgaaaccgggcggcacgctcaacgtcgtctacgaa
actgagaccgacgcgccgaccctcgccaatgtctgccagcacagctatttcaacctcgac
ggcggctcggacgcattcggccacgacatcatgatcgcggcagaccactacctgcccacc
gacgagcggcagattccgacgggcgagatccgccccgttgccggcaccgccttcgatctg
cgcgaaatgacctcgcttggaaggcagctggacggcggcggaatcgcctatgaccacaat
ttctgcctctcgccggagcgcgtgcagaagcgctccgtggcgctcgtacgcagcatcaat
tccggtgtgtcgctggaagtgctgacgacggagcccggcgtgcagctctataccggagaa
aagctcgacgtaccggttcccggcctcgaaggccgccgttacggccccttcgccggcttc
tgcctcgaaacgcagatctggcccgatgcggtgaaccacgaaggtttcccgaaggcggtg
ctgagaccgggcgaaacgctccggcaggaaacggattacgttttcacgaagaactga

DBGET integrated database retrieval system