KEGG   Sinorhizobium meliloti 1021: SMc03836Help
Entry
SMc03836          CDS       T00058                                 

Gene name
tesA
Definition
acyl-CoA thioesterase i protein (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sme01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3501860..3502549)
Genome map
AA seq 229 aa AA seqDB search
MDTDHQTIVRRFRNEPMALKDFLPILFGLTMTIVLSAAARAEPVSLVGFGDSLMAGYQLP
PEDAFPARLEKALKEKGIDVTIANAGVSGDTTSSGLARIDWSIPEGTDGVILELGANDAL
RGIPPEETRKNLEAMVARLKERGVAVLLAGMMAPPNMGPDYAARFNPIYPDLAKEHNLVF
YPFFLDGVVTEVGLKLDDGMHPNGGGVGVMVDRFLPTAELFVRSLAKGE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttggatacggatcatcaaacaattgtccgccgatttaggaacgaacctatggcattaaaa
gactttctgcccattttattcggcctgacaatgacaatcgtgttatcggcggcggctcgc
gccgagcccgtcagcctcgtcggcttcggcgacagcctgatggccggctaccaactcccc
ccggaagatgccttccccgcccgcctcgaaaaggccctgaaggaaaaggggatcgacgtc
acgatcgccaatgccggcgtttccggcgacacgacctccagcggtctcgcccgcatcgac
tggtcgatccccgagggcaccgacggcgtcatcctcgaactcggcgccaacgacgcgttg
cgcggcatccctccggaggagacgcgcaagaatctggaggcgatggtcgcacggctcaag
gagcgcggcgtcgccgtcctgctcgcgggaatgatggcgccgccgaacatggggccggat
tatgcggcgcgcttcaatccgatctatcccgacctcgcaaaggaacacaatctcgttttc
taccctttcttcctcgacggcgtcgtcaccgaggtcggcctgaagctcgacgacgggatg
catccgaacggcgggggtgtcggcgtcatggtagaccgcttcctgccgacggcggagctt
ttcgtccgctcacttgcgaaaggagaatga

DBGET integrated database retrieval system