KEGG   Sinorhizobium meliloti 1021: SMc03922Help
Entry
SMc03922          CDS       T00058                                 

Gene name
glgB1
Definition
(RefSeq) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00500  Starch and sucrose metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
Module
sme_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMc03922 (glgB1)
Enzymes [BR:sme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SMc03922 (glgB1)
Exosome [BR:sme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMc03922 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 1234521
NCBI-ProteinID: NP_386950
RhizoBase: SMc03922
UniProt: Q92M14
Position
3067709..3069919
Genome map
AA seq 736 aa AA seqDB search
MTVPPGKDPAPAPPGMLPAPEIAAILSGTHSNPFAVLGVHAAGKTYVARCFVPGAETVIA
ETLSGKELGTLERRDEAGFFEGPVALRKEQPIRYRARNDGGEWTVIDPYSFGPVLGPMDD
YYIREGSHLRLFDKMGAHPIRHDGAEGFHFAVWAPNARRVSVVGSFNDWDGRRHVMRLRV
DTGIWEIFIPGVPVGTPYKYEIVDSNGTLLPLKADPFARRSELRPDTASMTADEIAQNWE
DEAHRRHWAEIDPRRQPISIYEVHAASWQRRDNGDMLTWDELAERLIPYCVDMGFTHIEF
LPISEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEH
GLRWFDGTALYEHADPRQGFHPDWNTAIYNFGRQEVVAFLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRKHGEWVPNEYGGNENLEAVRFLQTMNTRIYGIHQGVLTIAEESTSWPKV
SHPVHAGGLGFGFKWNMGFMHDTLQYLSREPVHRKFHHNDMTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYGFMWGYPGKKLLFMGQEFAQWREWSEDRGLDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGDGFEWLIADDRENSVFAWLRKAPGE
KLVAVVTNFTPVYREHYDIPLPVAGRWKEVLNTDAEIYGGSGKGNGGAVHAEKRANGETI
ATITLPPLATLMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacggttccgcccggcaaggatccagcccccgccccgccaggcatgctgccagcgccg
gaaatcgcggcaatactttccggtacccacagcaaccccttcgccgtccttggagtgcat
gccgcgggcaagacctatgtcgcccggtgcttcgtgccgggtgcggaaacggtgattgcc
gaaacgctcagcggcaaggaactcggcacgctcgagcggcgcgacgaggccggcttcttc
gagggtccggtggcgctccgcaaagagcagcccatccgctaccgcgcccgcaacgacggc
ggcgagtggaccgtcatcgatccctacagcttcggccccgtgctcgggccgatggacgac
tactatatccgcgagggctcgcaccttcgcctcttcgacaagatgggcgcgcatccgatc
cggcatgacggcgccgagggttttcacttcgccgtctgggcgccgaacgcccgccgtgtg
tccgtggtcgggagtttcaacgactgggacggacgccggcatgtcatgcgcctgcgtgtc
gacaccggtatctgggagatcttcatccccggcgtgcccgtgggtacgccctataaatac
gaaatcgtcgacagcaacggcacgctgctgccgttgaaggccgacccctttgcccggcgc
tcggagctcaggcccgacaccgcttcgatgaccgcggacgagatcgcccagaactgggag
gacgaggcgcatcggcgtcactgggccgagatcgatccgcgccggcagccgatctcgatc
tacgaggtccatgcggcctcatggcagcgccgcgacaatggcgacatgctcacctgggac
gaactggcggaaaggctgatcccctattgcgtcgatatgggcttcacgcacatcgagttc
ctgcccatttcggaatatccctatgatccgtcctggggctatcagaccaccggcctctat
gcgccgaccgcacgcttcggcgagccagagggctttgcccgtttcgtcaacggctgccat
aaggtgggcatcggcgtcatcctcgactgggtgccggcgcattttccgaccgacgaacac
gggcttcgctggttcgacggcaccgcgctttacgagcatgcggatccgcgccaggggttc
catcccgactggaacacggcgatctacaatttcggccgtcaggaggtcgtcgcctttctg
gtcaacaacgctctctactgggcggagaaattccatgtcgacggcctgcgcgtcgatgcg
gtcgcctcgatgctctatctcgactattcgcgcaagcatggcgaatgggtgccgaacgaa
tatggcggcaacgaaaatctcgaggccgtgcgtttcctgcagacgatgaacacccgcatc
tacggcatccaccagggcgtgctgaccatcgccgaggaatcgacgtcctggccgaaggtc
tcgcacccggtgcatgccggcgggctcggcttcggcttcaagtggaacatgggcttcatg
cacgacacgctgcaatatctctcgcgcgagcccgtgcaccgaaagttccaccacaacgat
atgaccttcgggctgctctacgccttcagcgagaatttcgtgctgccgctgtcccatgac
gaggtcgtccacggcaaggggtcgctgatcgccaagatggccggcgacgactggcagaag
ttcgccaatctccgcgcctattacggcttcatgtggggctatcccggcaagaagctcctt
ttcatgggacaggaattcgcccaatggcgcgaatggtcggaggaccgcggtctcgactgg
aacctgctcgaatacaatctgcatgaggggatgcgccgtctggtgcgcgacctgaacggc
acctatcgctcgaagccggcgctgcatgcgcgcgactgcgagggcgacggtttcgaatgg
ctgattgccgacgatcgtgagaattccgtcttcgcctggctgaggaaagcgcccggagag
aagctggtcgcggtcgtcaccaacttcactccggtttaccgggagcattacgacataccg
cttccggtggcagggcgctggaaggaagtcctcaataccgacgcggaaatctatggagga
agtggcaagggcaacggcggcgccgtccatgcagagaagagagcgaacggagagacgatc
gccaccatcacgctgccgcctctggcgacgctgatgctggagcaggattag

DBGET integrated database retrieval system