KEGG   Sinorhizobium meliloti 1021: SMc03966Help
Entry
SMc03966          CDS       T00058                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sme03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2960088..2960705)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGTIDEIGEDHVVLDVHGVGYVAHCSARTLGKLGSAGEAAVLFIETYVREDQLKL
FGFLSALEREWFRLLQSVQGVGSKVALAVLSTLTPGELANAIALQDKTSISRAPGVGPKV
AVRIVTELKNKAPAFSGEMAPSIGLKQELGEGVAAAPVADAVSALTNLGYSRDQAANAVA
AALKNGGEGGDSAKLIRLGLKELSR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagctgaagggcacgatagacgagatcggcgaggatcacgtggttctcgac
gtgcatggggtcgggtatgtcgcccattgctccgcgcgcacgctcggaaagctcggaagc
gctggagaggcggccgtactcttcatcgagacctatgtgcgcgaggatcagctgaagctg
ttcgggttcctgagcgcgttggagcgcgaatggttccgcctgcttcagagcgttcagggt
gtgggatccaaggtggcgctggcggtgctctccacgctgacccccggggaactcgccaat
gccatcgccttgcaggacaagacgtcgatctcgcgcgcgccgggcgtgggtccgaaagtt
gccgtgcgcatcgtcaccgaactcaagaacaaggctccggccttctccggcgagatggca
ccatcgatcggcctcaagcaggagctcggcgaaggcgttgccgcagcgccggttgcggac
gcggtctcggcgctcaccaatctcggctattcgcgagaccaggcggccaacgccgttgcg
gctgcgctgaaaaacggcggggagggcggcgacagcgccaagctgatccgcctcggcttg
aaggaactgtcgcggtga

DBGET integrated database retrieval system