KEGG   Sinorhizobium meliloti 1021: SMc04041Help
Entry
SMc04041          CDS       T00058                                 

Gene name
pldB
Definition
lysophospholipase L2 protein (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMc04041 (pldB)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SMc04041 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3044772..3045755
Genome map
AA seq 327 aa AA seqDB search
MTTLLHSMPENPMPGDPVVGFFDGARNRKIRYAVFRSKAPVIRGTIVLLQGRNESIEKYF
ETIGDLMAAGFWVATFDWRGQGGSERLSPQWTHGHVEDFTDYERDLTIFLDEIVLPDTRL
PFSIVAHSMGALVALSLAPMLASRIDRMVLLAPFVGLGGQAIGERGIAAIATVMRWIGLG
RLALSSDKGNGTPFRGNVLTADDRRYARNLALIDARPQLRVGPPTARWLSEAFRTIRRVL
KHEHLTRITIPAVILAPTADKLVPYLPVERLASNFRAGHLIPIDGARHELLQEADRYRAQ
AMAAILAFLPGADAEDPASLPRQLEEA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctccttcactcgatgccggaaaatccgatgccgggcgatccggtggttggc
tttttcgacggagcccgcaaccgcaagatccgctacgcggtgttcaggtcgaaggccccg
gtcattcgcggcaccatcgtcctgctgcagggtcgcaacgagtcgatcgagaaatacttc
gaaacgatcggcgatctcatggcggccggtttctgggtcgcgaccttcgactggcgcgga
cagggcggctccgagcggctgtcgccgcaatggacccacggccatgtggaggatttcacc
gattacgagcgcgacctgacgatttttctcgatgagatcgtccttcccgacacccgcctg
cccttctcgatcgtcgcccattcgatgggggcgctcgtcgccctgtcgctcgctcccatg
ctcgcaagccgcatcgaccggatggtgctgcttgcccccttcgtcggtctggggggccag
gcgatcggcgaacggggtatcgcagcgatcgcgacggtcatgcgctggatcggcctcggg
aggctggcgctgagttccgacaaaggcaacggtaccccttttaggggcaatgttctgacc
gcggacgaccggcgctacgcccgcaacctggcgctcatcgatgcgcgtccgcaactgcgg
gtcggaccgcccacggcccgctggctgagcgaggccttccgaacgatccggcgcgtcctc
aagcacgaacatctgacgaggatcaccataccggccgtcatactcgccccgacggccgat
aagctcgtgccgtatctcccggtcgagcggttggccagcaatttccgtgcggggcatctg
atcccgatcgacggcgcgcggcacgaactcctgcaggaggccgaccgctatcgcgcccag
gcgatggccgcgatcctggcctttctgccgggcgccgatgcggaggaccccgcgtccctg
ccgcgacagttggaagaggcttaa

DBGET integrated database retrieval system