KEGG   Sinorhizobium meliloti 1021: SMc04270Help
Entry
SMc04270          CDS       T00058                                 

Definition
dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMc04270
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMc04270
  Lipid metabolism
   00071 Fatty acid degradation
    SMc04270
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMc04270
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMc04270
   00626 Naphthalene degradation
    SMc04270
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMc04270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2097348..2098376)
Genome map
AA seq 342 aa AA seqDB search
MRALQLLDDRKLEITDVPEPEAPGPGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVESIGPGVANVLPGQLVSIYGARTCGLCRPCREGRDNLCEHVGGVHGFHLDGFA
QEKVNLPARLLVPAPPGVDEIGAALAPVTFGTVEHMLFDNAKLEPGETILVHAGGSGIGT
AAIQLAKKIGCTVITTVGSDDKIDRAKALGADHVINYRIDRFEGVVRKLTKKKGVDVVFE
HVGKDTWAGSMLSMKRGGRLVTCGSTSGVSTDMNLMMLFQQQLKLLGSFGCRMENMANAM
QKMGRGLIHPVIDTEVGLNDIDRALERMESRQIFGKIVLRMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctgcaattgctcgatgaccgcaagcttgaaatcaccgatgtgccggagccg
gaggcgcccggtcctggcgaggtgacgctgcgggtcaaggcggtcgcgctcaatcatatc
gacgtctggggctggcgcggcatggctttcgccaagcgcaagatgccgctcgtcatcggc
gcggaagcctccggcgtcgtggagagcatcggcccgggcgtcgccaatgtgctccccggc
cagctcgtctcgatctacggtgcgcgtacctgcggcctctgccgcccgtgccgcgagggg
cgcgacaatctctgcgaacatgtcgggggcgtccatggcttccatctggacggcttcgcg
caggagaaggtcaaccttccggcgcgcctgttggtgcctgcaccccccggcgtcgacgaa
atcggcgcggcgctggcgccggtcaccttcggtaccgtcgagcacatgttgttcgacaac
gccaagctcgaacccggcgagacgatcctcgtccatgccggcggatccggtatcggcacg
gccgcgatccagctcgccaagaagatcggttgcacggtcatcaccacagtcggatcggac
gacaagatcgacagggcgaaggcgctcggtgccgaccacgtcatcaactaccggatcgat
cgtttcgaaggcgtggtgcggaagctgacgaagaaaaagggcgtcgatgtcgtcttcgaa
catgtcgggaaggatacctgggcgggctcgatgctgtcgatgaagcgtggtggacgcctc
gtcacctgcggctcgacttccggtgtctcgaccgacatgaatctgatgatgctgttccag
cagcagctgaaactgctcggctccttcggctgccgaatggagaacatggcgaacgccatg
cagaagatggggcgcgggctcattcacccggtgatcgacaccgaggtggggctcaacgat
atcgaccgcgcgctggagcgtatggagtcgcgccagatcttcggcaagatcgtgttgcgg
atggattga

DBGET integrated database retrieval system