KEGG   Sinorhizobium meliloti 1021: SMc04270Help
Entry
SMc04270          CDS       T00058                                 

Definition
(RefSeq) dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00010  Glycolysis / Gluconeogenesis
sme00071  Fatty acid degradation
sme00350  Tyrosine metabolism
sme00625  Chloroalkane and chloroalkene degradation
sme00626  Naphthalene degradation
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMc04270
  Lipid metabolism
   00071 Fatty acid degradation
    SMc04270
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMc04270
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMc04270
   00626 Naphthalene degradation
    SMc04270
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMc04270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 NADH_4Fe-4S MAF_flag10
Motif
Other DBs
NCBI-GeneID: 1233603
NCBI-ProteinID: NP_386044
RhizoBase: SMc04270
UniProt: Q92P55
Position
complement(2097348..2098376)
Genome map
AA seq 342 aa AA seqDB search
MRALQLLDDRKLEITDVPEPEAPGPGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVESIGPGVANVLPGQLVSIYGARTCGLCRPCREGRDNLCEHVGGVHGFHLDGFA
QEKVNLPARLLVPAPPGVDEIGAALAPVTFGTVEHMLFDNAKLEPGETILVHAGGSGIGT
AAIQLAKKIGCTVITTVGSDDKIDRAKALGADHVINYRIDRFEGVVRKLTKKKGVDVVFE
HVGKDTWAGSMLSMKRGGRLVTCGSTSGVSTDMNLMMLFQQQLKLLGSFGCRMENMANAM
QKMGRGLIHPVIDTEVGLNDIDRALERMESRQIFGKIVLRMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctgcaattgctcgatgaccgcaagcttgaaatcaccgatgtgccggagccg
gaggcgcccggtcctggcgaggtgacgctgcgggtcaaggcggtcgcgctcaatcatatc
gacgtctggggctggcgcggcatggctttcgccaagcgcaagatgccgctcgtcatcggc
gcggaagcctccggcgtcgtggagagcatcggcccgggcgtcgccaatgtgctccccggc
cagctcgtctcgatctacggtgcgcgtacctgcggcctctgccgcccgtgccgcgagggg
cgcgacaatctctgcgaacatgtcgggggcgtccatggcttccatctggacggcttcgcg
caggagaaggtcaaccttccggcgcgcctgttggtgcctgcaccccccggcgtcgacgaa
atcggcgcggcgctggcgccggtcaccttcggtaccgtcgagcacatgttgttcgacaac
gccaagctcgaacccggcgagacgatcctcgtccatgccggcggatccggtatcggcacg
gccgcgatccagctcgccaagaagatcggttgcacggtcatcaccacagtcggatcggac
gacaagatcgacagggcgaaggcgctcggtgccgaccacgtcatcaactaccggatcgat
cgtttcgaaggcgtggtgcggaagctgacgaagaaaaagggcgtcgatgtcgtcttcgaa
catgtcgggaaggatacctgggcgggctcgatgctgtcgatgaagcgtggtggacgcctc
gtcacctgcggctcgacttccggtgtctcgaccgacatgaatctgatgatgctgttccag
cagcagctgaaactgctcggctccttcggctgccgaatggagaacatggcgaacgccatg
cagaagatggggcgcgggctcattcacccggtgatcgacaccgaggtggggctcaacgat
atcgaccgcgcgctggagcgtatggagtcgcgccagatcttcggcaagatcgtgttgcgg
atggattga

DBGET integrated database retrieval system