KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0118Help
Entry
C770_GR4Chr0118   CDS       T02405                                 

Definition
Glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:smeg00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(129538..130179)
Genome map
AA seq 213 aa AA seqDB search
MKLFYSRNPNPRLAVAVARHLAAEVEFEFASPFAPGQAERFRPLNPNLSLPILVEAGKSL
WEADAIACRLSRAMQSDFWRIGDDEPDMVRWISWGKENFVRACDMVQFERGTKQRYGLGP
IDQQLVEEGLSMFRTAAAILDMELSGRNWLVGGAVSHADFRMATFLPFNDAAGLPLGDYP
NICRWIDRLEEIDAWRDPFRGLDAPELPPVPER
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacagccgcaatcccaatccgcgtcttgccgtcgcggtggcacgccat
ctcgcagccgaggtcgagttcgagttcgcctcgcccttcgcgccggggcaggcggaacgg
tttcggccgctcaacccgaacctttcgctgccgatactcgtggaggccggaaaaagcctt
tgggaggccgacgcgatcgcctgccggctttcacgcgcgatgcaatcggatttctggcgc
atcggcgacgacgaacccgacatggtccgatggatcagctggggcaaggaaaacttcgta
cgagcttgcgacatggtgcagttcgagcgcggcacgaagcagcgctatgggctcggcccg
atcgaccagcagctggtcgaggaggggctgagcatgttccgtacggcagcggcgatactc
gatatggagctttccgggcggaactggctggtcggaggcgccgtgtcccatgcggatttc
cgaatggcgacctttctgcccttcaacgatgccgccgggctgccgcttggcgattatccc
aacatctgccgctggattgaccggctcgaggagatcgatgcctggcgcgatcccttcagg
ggactggatgcgcccgaactgccgcctgtcccggagcgctga

DBGET integrated database retrieval system