KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0137Help
Entry
C770_GR4Chr0137   CDS       T02405                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    C770_GR4Chr0137
Enzymes [BR:smeg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     C770_GR4Chr0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
151401..152723
Genome map
AA seq 440 aa AA seqDB search
MAMLPQEIIRKKRDGDRLDPAEIAGFIAGVTDGSVSEGQAAAFAMAVWFSGMNRDECVAL
TLAMRDSGETLDWSDLARPIVDKHSTGGVGDNVSLMLAPIVAACGAAVPMISGRGLGHTG
GTLDKLESIPGYDIQPSPELFRRVADEVGCAIIGQTADLAPADKRLYAIRDVTATVDSVP
LITASILSKKLAAGLRSLVLDVKLGNGSFMTDPAETEVLARSLVEVANGAGVRTSALITD
MNEPLADAAGNALEIENCLAYLRGEKAGTRLDQVVMALAAEMLVAAGIAAHEAEAEAMAR
RVLGSGEAMERFGLMVHRLGGPADFVDRPGAYLAKAPAILAVPAGRHGYLTSCKTRELGM
AVIELGGGRIRPDDRIDHRVGLTGLRPLGTKVEKGEPIAFVHAADQSQAEAIAKRVVTLY
AIADEEPARRPVIVSKLRAG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcttccgcaggaaatcatacgaaagaaaagggacggcgatcggctcgatccg
gcggagatcgccggtttcatcgcgggcgtgaccgatggctcggtctcggaagggcaggcg
gctgccttcgccatggcggtctggttctccggcatgaatcgcgacgaatgcgtggcgctg
acgctggcgatgcgcgattccggggaaacgctcgactggagcgatctcgcacgccccatt
gtcgacaagcactcgacgggcggagtcggcgacaatgtctcgctcatgttggcgccgatc
gtcgccgcctgcggtgcggccgtgccgatgatttcgggccgggggctcggccacaccggc
gggacgctcgacaagctcgaatcgatccccggctatgacatccagccttcgccggaactg
ttccgccgcgtggccgacgaggtcggctgcgcgatcatcggccagacggccgatctggcg
ccggccgacaagcgcctctatgcgatccgcgacgtgacggcgacggtcgattcggtgccg
ctgatcaccgcatcgatcctgtcgaaaaagctcgccgcagggctacggtcgctggtgctc
gacgtcaagctcggcaacggctccttcatgaccgatcctgccgaaaccgaagtcctggcg
cgttcgcttgtcgaggtcgccaatggtgcgggcgtgcgcacctctgcgctgatcaccgac
atgaacgagccgctggcggacgcggccggcaacgcgctcgaaatcgagaactgcctggcc
tatctgcgcggcgagaaagcgggaacccgcctcgatcaggtcgtgatggccttggctgcg
gagatgctcgttgcagcgggtattgcggctcacgaagccgaagccgaagccatggcgcgg
cgcgttttggggagcggggaggcgatggagcgcttcggcctcatggtgcatcggctcggc
ggccctgccgattttgtcgatcgcccgggcgcctatcttgccaaggcacccgcgatcctt
gccgtgccggcgggccggcatggttatctcacgtcctgcaagacgcgcgaactgggaatg
gcagtcatcgagctcggcggcgggcgcatccgcccggatgaccggatcgatcaccgcgtc
ggtcttaccggcctgaggccgctcgggacgaaagtcgaaaagggcgagccgatcgccttc
gtccatgctgccgaccaaagccaggccgaggcgatcgcaaaacgggtcgtaacgctctat
gcgatcgcagacgaggagccggcgcgacggccggtgatcgtttcgaagctcagagcggga
tga

DBGET integrated database retrieval system