KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0229Help
Entry
C770_GR4Chr0229   CDS       T02405                                 

Definition
Cytochrome c2
Orthology
K08738  
cytochrome c
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    C770_GR4Chr0229
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C770_GR4Chr0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(250180..250959)
Genome map
AA seq 259 aa AA seqDB search
MNPYVNMGVGALLGTVFVLMSVSIASEGIFHSEAPEKEGFAIVAEETAGEADAAGGEEAK
SEPIGPMLASADASAGEGVFKKCASCHTVEKGGPNKVGPNLWSVVNRPVASHEGFSYSAG
MQTFAEGGKVVWDYDHLSYFLEAPKKHVPGTAMGFAGIKKVDERANLIAWLREQADSPAP
LPDAGAAGSTEAAPAAGQEGQAPAAAEGAAAPAPAEGGAAPAATEASPAPAEGGATPAPA
EGEAAPAGQIGAPAPAPAN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatatgtgaacatgggtgtgggtgccttgttgggtacggtcttcgttctgatg
tccgtatccattgcgtcggaaggcattttccattccgaagctcccgagaaggaaggtttc
gccattgtcgccgaggaaacggcaggcgaagcggatgctgccggcggcgaggaagcgaag
tccgagccgatcgggccgatgctcgccagcgccgatgcctccgccggcgagggcgtgttc
aagaaatgcgcaagctgtcacaccgtggagaagggcggaccgaacaaggtcggcccgaat
ctctggagcgtcgtcaaccgcccggtcgcctcgcatgagggcttcagctattccgcgggc
atgcagaccttcgcagaaggcggcaaggtcgtgtgggactacgatcatctgagctacttc
ctcgaagcgccgaagaagcacgtgcccggcacggcgatgggcttcgccggcatcaagaaa
gtcgacgagcgcgccaacctgatcgcctggctgcgtgagcaggcggacagcccggccccg
ctgccggacgccggcgcggcaggctcgaccgaggcggcaccggctgctggtcaggaggga
caggcccccgccgctgccgaaggtgccgcagctcccgctccagctgaaggcggtgcggcc
cctgcagccactgaagccagcccggccccggctgaaggcggagcaactcccgccccggct
gaaggcgaggctgctccggcaggtcagatcggcgctccagcgccggctccggcaaactga

DBGET integrated database retrieval system