KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0241Help
Entry
C770_GR4Chr0241   CDS       T02405                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    C770_GR4Chr0241
DNA repair and recombination proteins [BR:smeg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      C770_GR4Chr0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259083..259688
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCTDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGI
GPEDLNIRGLIDRVAKGGVRELIIAVNATVEGQTTAHYITDQLEGMEVRITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtccggaaatcgagaaactcatccagctcctggcgaaagtc
ccgggcctcgggccccgttccgcccgccgcgcggcgctgcatctcgtcaagaagaaggag
cagttgctcggcccccttgccgaggctatgggcgaagcccatcgtaaggtcaagatctgc
tcctgctgcggcaatgtcgacaccatcgacccctgcacggtctgcaccgacgaacggcgc
gaccaggcggtgatcatcgtggtcgaggacgtcgccgatctttgggcgctggagcgcgcc
ggcgccatgaatgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacggcatc
gggcctgaggatctgaacataaggggcctcatcgaccgcgtcgccaagggtggcgtgcgc
gagctgatcatcgccgtcaacgcgaccgtcgagggccagacgacggcgcactacatcacc
gatcaactcgaaggcatggaggtgagaatcacgcgcctcgcccatggcgtgcccgtcggc
ggcgagctcgactatctcgacgagggaacgctggccgccgcgcttagggcgagaacggtg
atttga

DBGET integrated database retrieval system