KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0375Help
Entry
C770_GR4Chr0375   CDS       T02405                                 

Definition
(GenBank) Enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00071  Fatty acid degradation
smeg00280  Valine, leucine and isoleucine degradation
smeg00281  Geraniol degradation
smeg00310  Lysine degradation
smeg00360  Phenylalanine metabolism
smeg00362  Benzoate degradation
smeg00380  Tryptophan metabolism
smeg00410  beta-Alanine metabolism
smeg00627  Aminobenzoate degradation
smeg00640  Propanoate metabolism
smeg00650  Butanoate metabolism
smeg00903  Limonene and pinene degradation
smeg00930  Caprolactam degradation
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
smeg01212  Fatty acid metabolism
Module
smeg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    C770_GR4Chr0375
   00650 Butanoate metabolism
    C770_GR4Chr0375
  Lipid metabolism
   00071 Fatty acid degradation
    C770_GR4Chr0375
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C770_GR4Chr0375
   00310 Lysine degradation
    C770_GR4Chr0375
   00360 Phenylalanine metabolism
    C770_GR4Chr0375
   00380 Tryptophan metabolism
    C770_GR4Chr0375
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C770_GR4Chr0375
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C770_GR4Chr0375
   00281 Geraniol degradation
    C770_GR4Chr0375
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C770_GR4Chr0375
   00627 Aminobenzoate degradation
    C770_GR4Chr0375
   00930 Caprolactam degradation
    C770_GR4Chr0375
Enzymes [BR:smeg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C770_GR4Chr0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGA05351
Position
392856..393629
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKA
FAAGADIKEMQGLDFVDGYLADFLGGWEHVANARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVV
APDRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQK
EGMAAFVAKRKAEFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgttgctggtcgaaacgcagggccgcgtgggcctgatcacgctcaac
cgtccgcaggcgctcaatgcgctgaatgcggtgctgatgcgcgagctcgatgccgcgctg
aaggccttcgacgccgacagggccgtcggcgccatcgtccttgccggctccgagaaggcc
tttgccgccggcgccgacatcaaggagatgcaggggctcgatttcgtcgacggttacctc
gccgatttccttggcggctgggagcatgtcgcgaacgcccgcaaaccgatgatcgccgcc
gtatccggtttcgcgctcggcggtggctgcgagctcgccatgatgtgcgacttcatcatc
gcctccgaaacggcgaagttcggccagccggagattacgcttggcgtcattcccggcatg
ggtggatcgcagcgcctgacccgcgcagtcggcaaggcgaaggccatggacctcattctc
accggccgcatgatggacgcggcggaggcggagcgctccgggctggtttcgcgcgtggtg
gctccggacaggctcctggaggaggcgctcggcgccgcggagaagatcgcgtcattctcg
ctgccggcggcgatgatggccaaggaggccgtcaaccgctctctggaactgacgctcgcc
gagggcctgcgcttcgagcggcggctcttccagtcgcttttcgcaacggaggaccagaaa
gagggcatggccgccttcgtcgccaagcgcaaagccgaattcaaacacagatga

DBGET integrated database retrieval system