KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0574Help
Entry
C770_GR4Chr0574   CDS       T02405                                 

Definition
bifunctional amidases related to nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    C770_GR4Chr0574
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     C770_GR4Chr0574
    3.5.1.-  
     C770_GR4Chr0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623542..624141
Genome map
AA seq 199 aa AA seqDB search
MADEALIVIDMQNDFCPGGALAVEGGDEIVPAVNRLIDASPHVVLTQDWHPAGHSSFAST
HPGKAPFQTVAMPYGEQTLWPEHCVQGSAGADFHPSLRWTSAELVIRKGFRREIDSYSAF
FENDHRTPTGLAGYLRERGIKSVTLCGLATDFCVAFSALDAVAKGFSTSVVLGACRGIDL
NGSLAAMTLRMRDAGVRLI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaagccctgatcgttatcgatatgcagaacgacttctgccccggcggcgct
ctcgcggtcgagggcggcgatgaaatcgtgcccgccgtcaatcgcctcatcgacgcgtcg
ccgcatgtcgtcctgacgcaggactggcacccggccggccattccagtttcgcctcgacg
catccgggcaaggctccgtttcagaccgtggcgatgccttacggagagcagacgctctgg
cccgagcattgcgtccaggggagcgccggtgccgattttcatccgtccctgcgatggacc
tcggcggagctcgtcatacgcaagggcttccgtcgcgagatcgacagttattccgccttt
ttcgaaaacgaccaccggaccccgaccgggcttgccggttacctgcgcgagcgcggcata
aaaagcgtgacgctttgcggcctggctaccgatttctgcgttgccttctcggcactcgat
gcggtcgccaagggtttttcgacgtcggtggtgctcggcgcctgccgtggcatcgatctg
aacggctcgcttgcggccatgaccctgcgcatgcgcgatgccggcgtccggctgatctag

  All links  
No link information was found.   
DBGET integrated database retrieval system