KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0701Help
Entry
C770_GR4Chr0701   CDS       T02405                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C770_GR4Chr0701
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C770_GR4Chr0701
Enzymes [BR:smeg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     C770_GR4Chr0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(746442..747731)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNAPEGRFDGIERPYSAEDVKRLRGSVEIRYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINRT
LQRADQIETAEGKGLSVETWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLVIARTDAEAAKLLTSDIDERDR
PFVDYDAGRTVEGFYQVKNGIEPCIARAIAYAPHCDLIWCETSKPDLEQARKFAEGVHKA
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YRDRQMAAYSELQEAEFAAEANGYTATKHQREVGTGYFDAVSVAITGGQSSTTAMKESTE
HDQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttacaagctcgttccaaatgcgccggaggggcgcttcgacggaatcgag
cggccctattccgccgaggacgtgaagcggctcaggggctcggtggagatccgttattcg
cttgccgaaatgggggcgaaccgcctctggaagctcattcacgaggaggacttcgtcaac
gcactcggcgcgctttccggcaatcaggcgatgcagatggtgcgcgcaggcttgaaggcg
atctatctctccggctggcaggttgcagccgacgccaacaccgcttcggccatgtatccg
gaccagtcgctctatccggccaacgcggctccggaactcgccaagcgcatcaaccgcacg
cttcagcgcgccgaccagatcgagacggcggaaggcaagggtctctccgtcgagacctgg
ttcgcgccgatcgtcgccgacgcggaagccggcttcggcgggccgctcaacgccttcgag
atcatgaaggccttcatcgaagcgggtgcggcgggcgtccattacgaggaccagctcgcg
tcggaaaagaagtgcggccatctcggcggcaaggtgctgatcccgaccgcggctcatatt
cgcaatctgaacgcggcacggcttgccgccgacgtgatgggcacgccgacgctggtcatc
gcccgcacggacgcggaagcggcgaaactgctcacctctgatatcgacgagcgcgaccgc
ccattcgtcgactatgatgccggccgcaccgtcgagggcttctaccaggtgaagaacggc
atcgagccctgcatcgcccgcgcgatcgcctatgcgccgcattgcgacctcatctggtgc
gagacctccaagcccgacctggagcaggcgcgcaaattcgccgaaggcgtgcacaaggca
catccgggcaagctgctcgcctataattgctcgccgtccttcaactggaagaagaacctc
gacgacgcgacgatcgccaagttccagcgcgaattgggcgccatgggctacaagttccag
ttcatcacgctcgccggcttccatcagctgaactacggcatgtttgaactggcgcgcggc
tacagggatcgtcagatggcggcctattcggagctgcaggaagcggaattcgctgccgaa
gccaacggctatacggcgaccaagcaccagcgcgaagtgggcaccggctatttcgatgcc
gtgtcggtcgcgatcaccggcggccagtcgtcgaccactgccatgaaggaatccaccgag
cacgatcagttccgcccggcagcagaatga

DBGET integrated database retrieval system