KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0787Help
Entry
C770_GR4Chr0787   CDS       T02405                                 

Definition
Glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C770_GR4Chr0787
Enzymes [BR:smeg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C770_GR4Chr0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834014..834823
Genome map
AA seq 269 aa AA seqDB search
MKAGNLPSTLTNATGAPYVGAADTLSISHLEASVMADLSSFPITARWPAKNPDIIQLYSL
PTPNGVKVSIALEELGLAYKAHRISFDTNEQKSPEFLSLNPNGRIPAIIDPNGPDGKPIG
LFESGAILIYLAEKTGKLLPADAARRYETLCWVMFQMGGIGPMFGQFGHFFKFAADKVAN
NPYPVQRYRDEAKRLLGVLEARLEGRQWLMGEEYTIADIATYPWVEGARKFYGGAEVLDY
KSFPNVMDWVDRGLARPAAQKGMEIPRKE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccggcaatttgccttccaccctgacaaatgcaaccggcgctccctatgttggg
gcggcagacaccctttcgatttcccacctagaggcatccgtcatggctgatctttcctcg
tttccgatcacggcacgctggccggcgaaaaatcccgatatcatccagctctattcgctc
ccgacgccgaatggcgtgaaggtctcgattgccctcgaagaactgggcctggcctataag
gcgcaccgcatttccttcgataccaacgagcagaagtcgcccgaattcctgtcgctcaat
ccgaacggccgcattccggcgatcatcgatccgaacggaccggacggaaagccgatcggc
ttgttcgaatccggcgcgatcctgatctatcttgcggaaaagaccggcaaactccttccg
gcggacgcggcccgccgctacgagacgctgtgctgggtcatgttccagatgggcggcatc
ggaccgatgttcgggcagttcggccatttcttcaaatttgccgccgacaaggtcgccaac
aacccctatcccgttcaacgctatcgcgacgaagcgaagcgtcttctcggcgtcctcgaa
gcgcggctcgagggccgtcaatggctgatgggggaggaatacaccatcgccgacatcgcg
acctatccctgggtggaaggggcgcggaagttctatggtggcgccgaggtgctcgactat
aagagcttcccgaatgtcatggactgggtggatcgcggcctggcacgccctgcggcccag
aagggcatggagatcccgcgcaaggagtag

DBGET integrated database retrieval system