KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0921Help
Entry
C770_GR4Chr0921   CDS       T02405                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C770_GR4Chr0921
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C770_GR4Chr0921
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    C770_GR4Chr0921
Enzymes [BR:smeg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     C770_GR4Chr0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(976350..977750)
Genome map
AA seq 466 aa AA seqDB search
MVKYISTRGEAASLGFCDALLAGLARDGGLYLPKEWPALSKKEIRALRGKSYQEIAFTVL
EPFTNGEIPAAKFREMIDEAYATFRHPAVAPLVQTGPNAFVMELFHGSTLAFKDVAMQLL
ARLMDYVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPQGKVSPVQQRQMTT
STASNVHAVAVKGNFDDCQNLVKAMFNDQAFRDRVKLSGVNSINWARIMAQIVYYFTTAV
ALGAPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKNGRYEMRD
VKATTSPSMDIQISSNFERLIFEANERDPAEVRAAMASLRQSGSFTIGDAALKKIRKEFR
AGRASEKDVAKTIRKTFDETGYLLDPHTAIGVFVATKHEKNSAPMVTLATAHPAKFPAAV
KSASGIDPTLPTWLADLMTRAERFDILDPELKSVETFIGERTRVRE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtatatttcgacacggggagaagcggcctctctcggcttttgcgatgctctt
ctggcgggacttgcccgcgacggcgggctttacctgccgaaggaatggccggcactctcg
aagaaggagatccgggcgctgcgcggcaaatcctatcaggagatcgccttcaccgttctc
gaacccttcaccaatggcgagatcccggcggccaagttccgcgagatgatcgacgaggcc
tatgccactttccgtcatccggccgtagcacccctggtccagaccggaccgaacgctttc
gtgatggagctctttcacggttcgacgctcgccttcaaggacgtcgccatgcagttgctc
gcccggctgatggactatgttcttgccgaacggggcgagcgggcgacgatcgtgggagcg
acatcaggcgataccggcggtgccgcgatcgacgccttcgccggccgcgaccgcaccgac
atcttcatcctctttccgcagggcaaagtgtcgccggtgcagcaaagacagatgaccacg
tccacggcatcgaacgtgcacgcggttgccgtcaaaggcaatttcgacgactgccagaac
ctggtcaaagccatgttcaacgaccaggccttccgcgaccgcgtgaagctttccggcgtc
aattcgatcaactgggcgcgcatcatggcccagatcgtctactatttcacgacggcggtc
gctctcggcgcgcccgaccggaagatctccttcaccgtgcctaccggcaatttcggcgat
attttcgcaggctacgtcgccaagcgcatgggtctgccgatcgacaagctgatcatcgcc
accaacgaaaacgacattctggcgcgcacgctgaagaacggccgctacgagatgcgcgac
gtcaaggcgacgacctcgccttcgatggacatccagatctcgtcgaacttcgaaaggctc
atcttcgaggcgaacgagcgcgatccggcggaagtccgcgcggccatggcgagcctcagg
caatccggctcgttcacgatcggcgacgcagcgctgaaaaaaatccgcaaggaatttcgc
gccggccgcgcctcggagaaagatgtggcgaaaacgatccgcaagaccttcgacgagacc
ggctatctccttgatccgcatacggcaatcggcgttttcgtggcaaccaagcacgagaag
aactccgccccgatggtcacccttgcgactgcccatccggcaaaatttcccgccgcagta
aaatcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctcatgactagg
gcggagcgtttcgacatcctggatccggagctcaagagcgtcgaaaccttcatcggcgag
cgtacccgcgttcgggaatag

DBGET integrated database retrieval system