KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr1467Help
Entry
C770_GR4Chr1467   CDS       T02405                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C770_GR4Chr1467
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C770_GR4Chr1467
   00020 Citrate cycle (TCA cycle)
    C770_GR4Chr1467
   00620 Pyruvate metabolism
    C770_GR4Chr1467
Enzymes [BR:smeg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C770_GR4Chr1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1527461..1528804
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAAPAPKPKETAETAPAAAPAPAAA
PAPQAAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVS
GGAAKPAGAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTI
PHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDQNMVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDH
RCVDGALGAELLAAFKRYIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtggaagccgtcgatgagggcacggtcgccaagatcgtt
gttcccgccggcactgaaggcgtcaaggtcaatgcgctgatcgcggttctcgccgccgag
ggcgaagacgtcgcgactgccgccaagggcggcaacggtgcagcgggagcagccccggca
ccgaagccgaaggaaacggccgaaacggcaccggccgcggctccggcacccgccgcagcg
ccggcaccgcaagctgctgctccggcttctcctgcgcccgccgatggcgaaggcaagcgc
atcttttcgtcgccgctggcacgccgcctcgcgaaggaggcaggcatcgacctttcggcg
atcgccggttccggaccgcatggccgcgtcgtcaagaaggacgtcgagacagccgtttcc
ggtggcgccgccaagcccgccggcgcgccggcagcagctccggccccggcgacgctcgct
aagggcatgtcggaggacgccgtcctcaagctcttcgagccaggctcctacgaactcgtg
ccgcatgacggcatgcgcaagacgatcgccaagcgcctcgtcgaatcgaagcagacgatc
ccgcatttctatgtttcggtcgattgcgagctcgacgcgcttatggcgctgcgcgcccag
ctgaatgccgcagcacctgaaaaggatggtaagccggtctacaagctttccgtgaacgac
atggtgatcaaggcgcttgctctggcgctgcgcgacgttccggatgcgaatgtgtcctgg
accgatcagaacatggtcaagcacaagcacgcggacgtcggcgtggccgtctccatcccc
ggcggcctgatcacgcccatcgtccgccaggcggagttgaagagcctctcggcgatctcc
aacgagatgaaggatctcggcaagcgcgcgaaggagcgcaagctgaagccggaagaatat
cagggcggcaccacggccgtctccaatatgggcatgatgggcgtcaaggacttcgccgcc
gtcgtcaatccgccgcacgcgacgatcctcgcggtcggcgccggcgaggaccgtgtcgtc
gtcaggaacaaggaaatggtcatcgccaatgtgatgaccgtcacgctttcgaccgaccat
cgctgcgtcgatggcgcgctcggcgccgaactgctcgccgccttcaagcgctacatcgaa
aacccgatgggtatgctcgtctga

DBGET integrated database retrieval system