KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr1544Help
Entry
C770_GR4Chr1544   CDS       T02405                                 

Definition
Beta-glucosidase-related glycosidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C770_GR4Chr1544
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    C770_GR4Chr1544
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     C770_GR4Chr1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616828..1617862
Genome map
AA seq 344 aa AA seqDB search
MQYAFRMSESKAFISGCKGLTLTQEERDFFAGERPWGFILFGRNIGEEEQIRDLVASLRD
SIGSPRAPVLIDQEGGRVQRIRPPLVQQYPNGAAIGEIYRRDRELGLRAAWLMGRLHAFD
LMRFGITVDCLPVLDVPVPGSHDVIGNRAYGHDPATVTAIGRAMSEGLKAGGMLPVMKHM
PGHGRTFVDSHHNLPVVSAGLDELKSSDFLPFAAMKDEAMAMSAHMVFTAIDPDNPATTS
AKVVREIIRGHIGFDGLLMSDDVSMNALAGDMTARAGGIIAAGLDLVLHCHGIMEEMKAV
ADVVPVLSGERLRRARAAEAAFREPDDAVEAALRAEFNAMFALA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcttttcgcatgagcgaatcaaaagcattcatatccggctgcaagggcctc
acgctgacgcaggaagaacgcgacttctttgcgggcgagcgcccatggggcttcatactg
ttcggacgcaatatcggcgaggaagagcagatccgcgacctggtggcgagcctgcgtgac
agcatcggcagcccccgggccccggtattgatcgatcaggagggcggtcgcgttcagcgc
atacgcccgccgctcgtgcagcaatatccgaacggcgcggccatcggtgaaatctatcgg
cgggacagggaactcggcctgcgtgccgcatggctcatggggcgtctgcatgccttcgac
ctgatgcgcttcggcattacggtcgattgcctgccggtactcgatgtgccggtacccggc
agccatgacgtgatcggcaatcgtgcctacgggcatgacccggcgacggtaaccgcgatc
ggtcgcgcgatgagcgaaggtttgaaggcgggcggcatgctgccggtgatgaagcacatg
cccggtcacggccggaccttcgtcgactcgcatcacaacctgccggtcgtcagcgccggt
ctcgatgaattgaagagcagcgattttctgcccttcgcggcaatgaaggacgaagcgatg
gccatgtcggcgcacatggtcttcactgctatcgacccggacaacccggcgacgacctct
gcgaaagtcgtgcgcgagatcatccggggccacatcggcttcgacggtctgctgatgtcc
gatgacgtctccatgaatgcgcttgccggcgacatgacggcacgtgccggcggaataatc
gccgccggtcttgatctcgtcttgcattgtcacggcattatggaagaaatgaaggccgtg
gcagatgtcgttccggttctctccggggagaggctccgccgggcgagggctgccgaggcc
gctttccgggaaccggacgacgcagtcgaagctgcactgcgcgcggagttcaacgcaatg
tttgcgctcgcctag

DBGET integrated database retrieval system